Recombinant Human IL24 protein, His-tagged
| Cat.No. : | IL24-2978H |
| Product Overview : | Recombinant Human IL24 protein(53-207 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 09, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 53-207 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | IL24 interleukin 24 [ Homo sapiens ] |
| Official Symbol | IL24 |
| Synonyms | IL24; interleukin 24; ST16; interleukin-24; C49A; FISP; IL 4 induced secreted protein; IL 24; IL10B; mda 7; melanoma differentiation association protein 7; Mob 5; suppression of tumorigenicity 16 (melanoma differentiation); melanocyte-associated Mda-7; IL-4-induced secreted protein; melanoma differentiation-associated gene 7 protein; MDA7; MOB5; |
| Gene ID | 11009 |
| mRNA Refseq | NM_001185156 |
| Protein Refseq | NP_001172085 |
| MIM | 604136 |
| UniProt ID | Q13007 |
| ◆ Recombinant Proteins | ||
| IL24-1925H | Recombinant Human IL24 Protein, MYC/DDK-tagged | +Inquiry |
| IL24-14189H | Recombinant Human IL24, GST-tagged | +Inquiry |
| IL24-2697R | Recombinant Rat IL24 Protein, His (Fc)-Avi-tagged | +Inquiry |
| IL24-510H | Recombinant Human IL24 Protein | +Inquiry |
| IL24-934H | Recombinant Human IL24 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL24-1922HCL | Recombinant Human IL24 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL24 Products
Required fields are marked with *
My Review for All IL24 Products
Required fields are marked with *
