Recombinant Active Human IL36RN Protein, His-tagged(C-ter)
| Cat.No. : | IL36RN-200H |
| Product Overview : | Recombinant Active Human IL36RN Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008] |
| Form : | Powder |
| Bio-activity : | Determined by its ability to inhibit IL-36 gamma-induced IL-8 secretion in PBMC cells. The ED50 for this effect is < 2 ng/mL in the presence of 500 ng/mL of recombinant human IL-36 gamma. |
| AA Sequence : | MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD |
| Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
| Purity : | > 98% (by SDS-PAGE) |
| Applications : | SDS-PAGE |
| Notes : | For laboratory research only, not for drug, diagnostic or other use. |
| Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
| Storage Buffer : | PBS (pH 7.4) |
| Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
| Gene Name | IL36RN interleukin 36 receptor antagonist [ Homo sapiens ] |
| Official Symbol | IL36RN |
| Synonyms | IL36RN; interleukin 36 receptor antagonist; IL1F5, interleukin 1 family, member 5 (delta); interleukin-36 receptor antagonist protein; family of interleukin 1 delta; FIL1; FIL1(DELTA); FIL1D; IL 1 related protein 3; IL 1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; interleukin 1 HY1; interleukin 1 receptor antagonist homolog 1; MGC29840; IL-1ra homolog 1; interleukin-1 HY1; IL-1 related protein 3; interleukin-1-like protein 1; family of interleukin 1-delta; IL1F5 (Canonical product IL-1F5a); interleukin 1 family, member 5 (delta); interleukin-1 receptor antagonist homolog 1; IL-1F5 (IL-1HY1, FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta); IL1F5; PSORP; |
| Gene ID | 26525 |
| mRNA Refseq | NM_012275 |
| Protein Refseq | NP_036407 |
| MIM | 605507 |
| UniProt ID | Q9UBH0 |
| ◆ Recombinant Proteins | ||
| IL36RN-151H | Recombinant Human IL36RN Protein, His-tagged | +Inquiry |
| IL36RN-5185H | Recombinant Human IL36RN Protein, GST-tagged | +Inquiry |
| IL36RN-4809H | Recombinant Human IL36RN protein, His-SUMO-tagged | +Inquiry |
| IL36RN-152H | Recombinant Human IL36RN Protein, His-tagged | +Inquiry |
| IL36RN-118H | Active Recombinant Human IL36RN Protein (Met1-Asp155), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL36RN-5239HCL | Recombinant Human IL1F5 293 Cell Lysate | +Inquiry |
| IL36RN-5240HCL | Recombinant Human IL1F5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL36RN Products
Required fields are marked with *
My Review for All IL36RN Products
Required fields are marked with *



