Recombinant Active Human TMPRSS2 Protein (107-492), N-FLAG and C-Myc/His-tagged

Cat.No. : TMPRSS2-13H
Product Overview : The recombinant protein contains the three extracellular domains (LDLRA, SRCR, serine protease) of TMPRSS2 with a C-terminal His(6)-tag. The target sequence begins with Lys107 and ends with Gly492. The protease is in its activated form, which means that the peptide bond between Arg255 and Ile256 is cleaved.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Flag&His&Myc
Protein Length : 107-492
Description : This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a type II transmembrane domain, a receptor class A domain, a scavenger receptor cysteine-rich domain and a protease domain. Serine proteases are known to be involved in many physiological and pathological processes. This gene was demonstrated to be up-regulated by androgenic hormones in prostate cancer cells and down-regulated in androgen-independent prostate cancer tissue. The protease domain of this protein is thought to be cleaved and secreted into cell media after autocleavage. This protein also facilitates entry of viruses into host cells by proteolytically cleaving and activating viral envelope glycoproteins. Viruses found to use this protein for cell entry include Influenza virus and the human coronaviruses HCoV-229E, MERS-CoV, SARS-CoV and SARS-CoV-2 (COVID-19 virus). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Bio-activity : Recombinant human TMPRSS2 cleaves the synthetic substrate Z-Gly-Gly-Arg-AMC with high efficiency (kcat/KM=2×10^5 M-1s-1). Its natural inhibitor HAI-2 completely blocks the TMPRSS2 activity at 1:1 molar ratio.
Molecular Mass : 50 kDa (including tags)
AA Sequence : KFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
Purity : More than 90% as determined by SDS-PAGE.
Storage Buffer : 0.15 mg/mL TMPRSS2 in 20mM HEPES, pH 7.4, 150mM NaCl.
Gene Name TMPRSS2 transmembrane serine protease 2 [ Homo sapiens (human) ]
Official Symbol TMPRSS2
Synonyms TMPRSS2; transmembrane serine protease 2; PRSS10; transmembrane protease serine 2; epitheliasin; serine protease 10; transmembrane protease, serine 2; EC 3.4.21.-
Gene ID 7113
mRNA Refseq NM_005656
Protein Refseq NP_005647
MIM 602060
UniProt ID O15393

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMPRSS2 Products

Required fields are marked with *

My Review for All TMPRSS2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon