Recombinant Mouse Tmprss2 protein, His-tagged
| Cat.No. : | Tmprss2-648M |
| Product Overview : | Recombinant Mouse Tmprss2 protein(Q9JIQ8)(105-490aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 105-490aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 44.7 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | WRFWDSNCSTSEMECGSSGTCISSSLWCDGVAHCPNGEDENRCVRLYGQSFILQVYSSQRKAWYPVCQDDWSESYGRAACKDMGYKNNFYSSQGIPDQSGATSFMKLNVSSGNVDLYKKLYHSDSCSSRMVVSLRCIECGVRSVKRQSRIVGGLNASPGDWPWQVSLHVQGVHVCGGSIITPEWIVTAAHCVEEPLSSPRYWTAFAGILRQSLMFYGSRHQVEKVISHPNYDSKTKNNDIALMKLQTPLAFNDLVKPVCLPNPGMMLDLDQECWISGWGATYEKGKTSDVLNAAMVPLIEPSKCNSKYIYNNLITPAMICAGFLQGSVDSCQGDSGGPLVTLKNGIWWLIGDTSWGSGCAKALRPGVYGNVTVFTDWIYQQMRANS |
| Gene Name | Tmprss2 transmembrane protease, serine 2 [ Mus musculus ] |
| Official Symbol | Tmprss2 |
| Synonyms | TMPRSS2; transmembrane protease, serine 2; transmembrane protease serine 2; epitheliasin; plasmic transmembrane protein X; D16Ertd61e; MGC6821; |
| Gene ID | 50528 |
| mRNA Refseq | NM_015775 |
| Protein Refseq | NP_056590 |
| ◆ Recombinant Proteins | ||
| TMPRSS2-1856H | Recombinant Human TMPRSS2 Protein (106-492 aa), His-tagged | +Inquiry |
| TMPRSS2-4599H | Recombinant Human TMPRSS2 protein, His-sumostar-tagged | +Inquiry |
| TMPRSS2-4596H | Recombinant Human TMPRSS2 protein, His-sumostar-tagged | +Inquiry |
| TMPRSS2-05943H | Recombinant Human TMPRSS2 Protein(106-492aa), MBP&His-Avi-tagged, Biotinylated | +Inquiry |
| TMPRSS2-05944H | Recombinant Human TMPRSS2 Protein(256-492aa), GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMPRSS2-910HCL | Recombinant Human TMPRSS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tmprss2 Products
Required fields are marked with *
My Review for All Tmprss2 Products
Required fields are marked with *
