Recombinant Active Human TNFSF18 Protein, His-tagged(C-ter)
Cat.No. : | TNFSF18-321H |
Product Overview : | Recombinant Active Human TNFSF18 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells. [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is < 2.5 ng/mL. |
AA Sequence : | MQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILIANPQEI |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 7.4) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | TNFSF18 tumor necrosis factor (ligand) superfamily, member 18 [ Homo sapiens ] |
Official Symbol | TNFSF18 |
Synonyms | TNFSF18; tumor necrosis factor (ligand) superfamily, member 18; tumor necrosis factor ligand superfamily member 18; AITRL; hGITRL; TL6; AITR ligand; GITR ligand; activation-inducible TNF-related ligand; glucocorticoid-induced TNF-related ligand; glucocorticoid-induced TNFR-related protein ligand; GITRL; MGC138237; |
Gene ID | 8995 |
mRNA Refseq | NM_005092 |
Protein Refseq | NP_005083 |
MIM | 603898 |
UniProt ID | Q9UNG2 |
◆ Recombinant Proteins | ||
TNFSF18-882H | Recombinant Human TNFSF18 Protein, His-tagged | +Inquiry |
Tnfsf18-169M | Recombinant Mouse Tnfsf18 protein, His/S-tagged | +Inquiry |
TNFSF18-277H | Recombinant Human TNFSF18, FLAG-tagged | +Inquiry |
TNFSF18-2222H | Recombinant Human TNFSF18 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFSF18-0199H | Recombinant Human TNFSF18 Protein (Glu74-Ser199), N-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF18-890HCL | Recombinant Human TNFSF18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFSF18 Products
Required fields are marked with *
My Review for All TNFSF18 Products
Required fields are marked with *
0
Inquiry Basket