Recombinant Active Mouse IFNL3 Protein, His-tagged(C-ter)
Cat.No. : | Ifnl3-125M |
Product Overview : | Recombinant Active Mouse IFNL3 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 29 (IL29) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is < 20 ng/mL. |
AA Sequence : | MDPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKGAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENINDSALTTILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFQLLLRDLKCVASGDQCV |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 7.4) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | Ifnl3 interferon lambda 3 [ Mus musculus (house mouse) ] |
Official Symbol | Ifnl3 |
Synonyms | IFNL3; interferon lambda 3; IL28B; IL28C; IL-28B; IL-28C; IFN-lambda-3; IFN-lambda-4; interferon lambda-3; cytokine Zcyto22; interferon, lambda 4; interleukin-28B; interleukin-28C |
Gene ID | 338374 |
mRNA Refseq | NM_177396 |
Protein Refseq | NP_796370 |
UniProt ID | Q8CGK6 |
◆ Recombinant Proteins | ||
IFNL3-405H | Active Recombinant Human IFNL3, His-tagged | +Inquiry |
IFNL3-3688H | Recombinant Human IFNL3 Protein (Val22-Val196), His tagged | +Inquiry |
IFNL3-60H | Recombinant Human IFNL3, His-tagged | +Inquiry |
IFNL3-437H | Recombinant Human IFNL3 Protein, His-tagged | +Inquiry |
Ifnl3-19M | Recombinant Mouse Ifnl3, His and MBP-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNL3-2059HCL | Recombinant Human IFNL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNL3 Products
Required fields are marked with *
My Review for All IFNL3 Products
Required fields are marked with *
0
Inquiry Basket