Recombinant Active Mouse IL25 Protein, His-tagged(C-ter)
Cat.No. : | Il25-183M |
Product Overview : | Recombinant Active Mouse IL25 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a cytokine that shares sequence similarity with interleukin 17. This cytokine can induce NF-kappaB activation, and stimulate the production of interleukin 8. Both this cytokine and interleukin 17B are ligands for the cytokine receptor IL17BR. Studies of a similar gene in mice suggest that this cytokine may be a pro-inflammatory cytokine favoring the Th2-type immune response. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010] |
Form : | Powder |
Bio-activity : | Measured by its ability to induce CXCL1 secretion in HT‑29 cells. The ED50 for this effect is < 1 ng/mL. |
AA Sequence : | MVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | 20 mM Sodium citrate (pH 4.5) and 0.2 M NaCl. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | Il25 interleukin 25 [ Mus musculus ] |
Official Symbol | Il25 |
Synonyms | IL25; interleukin 25; interleukin-25; interleukin 17E; Il17e; IL-17e; |
Gene ID | 140806 |
mRNA Refseq | NM_080729 |
Protein Refseq | NP_542767 |
◆ Recombinant Proteins | ||
IL25-1812H | Recombinant Human IL25 protein, His-tagged | +Inquiry |
Il25-8736R | Active Recombinant Rat Il25 protein(Val17-Ala169), hFc-tagged | +Inquiry |
IL25-151H | Recombinant Human IL25 Protein, His-tagged | +Inquiry |
IL25-1924M | Recombinant Mouse IL25 Protein | +Inquiry |
IL25-1321C | Recombinant Canine IL25 protein(Leu17-Ala169), hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL25-2910MCL | Recombinant Mouse IL25 cell lysate | +Inquiry |
IL25-2920HCL | Recombinant Human IL25 cell lysate | +Inquiry |
IL25-1261RCL | Recombinant Rat IL25 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL25 Products
Required fields are marked with *
My Review for All IL25 Products
Required fields are marked with *
0
Inquiry Basket