Recombinant Aequorea victoria Enhanced Yellow Fluorescent Protein, Biotin Labeled

• Cat.No.: EYFP-03A
• Product Overview: Biotin-conjugated recombinant Aequorea victoria enhanced yellow fluorescent protein was expressed in HEK293.

Specification

• Species: Aequorea victoria
• Source: HEK293
• Conjugation/Label: Biotin
• Description: Enhanced yellow fluorescent protein (eYFP) is one of the most widely used versions of fluorescent proteins in modern cell biology exhibiting fast intrinsic blinking and reversible photoactivation by UV light.
• Form: Lyophilized powder, slight yellow
• AASequence: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNR
• Molecular Mass: 30 kDa
• Purity: > 95%
• Stability: Upon arrival, the lyophilized protein may be stored for 2 weeks at 4 centigrade. For long term storage, it is recommended to store desiccated below -20 centigrade in a manual defrost freezer. Following reconstitution, the protein may be stored for 2 weeks under sterile conditions at -20 centigrade. For long term storage, it is recommended to make appropriate aliquots and store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Storage: Store at -20 centigrade.
• Reconstitution: Briefly spin the vial and bring the contents to the bottom prior to opening. It is recommended to reconstitute at 0.5-1 mg/mL with sterile deionized water.
• Shipping: Ambient temperature.

Gene Information

• Official Symbol: EYFP
• Synonyms: Enhanced yellow fluorescent protein; EYFP