| Species : |
Aequorea victoria |
| Source : |
HEK293 |
| Conjugation/Label : |
Biotin |
| Description : |
Enhanced yellow fluorescent protein (eYFP) is one of the most widely used versions of fluorescent proteins in modern cell biology exhibiting fast intrinsic blinking and reversible photoactivation by UV light. |
| Form : |
Lyophilized powder, slight yellow |
| AASequence : |
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNR |
| Molecular Mass : |
30 kDa |
| Purity : |
> 95% |
| Stability : |
Upon arrival, the lyophilized protein may be stored for 2 weeks at 4 centigrade. For long term storage, it is recommended to store desiccated below -20 centigrade in a manual defrost freezer. Following reconstitution, the protein may be stored for 2 weeks under sterile conditions at -20 centigrade. For long term storage, it is recommended to make appropriate aliquots and store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Storage : |
Store at -20 centigrade. |
| Reconstitution : |
Briefly spin the vial and bring the contents to the bottom prior to opening. It is recommended to reconstitute at 0.5-1 mg/mL with sterile deionized water. |
| Shipping : |
Ambient temperature. |
