| Source : |
HEK293 |
| Tag : |
His |
| Protein Length : |
Full length |
| Description : |
The use of EYFP as a photoswitchable emitter vastly expands the number of biological specimens immediately available for super-resolution imaging. |
| Form : |
Lyophilized powder, slight yellow |
| Molecular Mass : |
Recombinant protein has a calculated molecular weight of about 30 kDa. |
| AA Sequence : |
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK |
| Purity : |
> 95% |
| Applications : |
Protein-protein Interaction, Post-translational Modifications, ELISA, EIA, Western Blotting, Dot Blotting, Immunoprecipitation, Protein Array, etc. |
| Notes : |
This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use. |
| Storage : |
Upon arrival, the lyophilized protein may be stored for 2 weeks at 4 centigrade. For long term storage, it is recommended to store desiccated below -20 centigrade in a manual defrost freezer. Following reconstitution, the protein may be stored for 2 weeks under sterile conditions at -20 centigrade. For long term storage, it is recommended to make appropriate aliquots and store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Reconstitution : |
Briefly spin the vial and bring the contents to the bottom prior to opening. It is recommended to reconstitute at 0.5 - 1 mg/mL with sterile deionized water. |
| Shipping : |
Ice packs |
