Recombinant Enhanced Yellow Fluorescent Protein (Full length), N-His-tagged

Cat.No. : EYFP-12
Product Overview : Recombinant enhanced yellow fluorescent protein with a N-terminal histidine tag was expressed in Human Embryonic Kidney 293 Cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : HEK293
Tag : His
Protein Length : Full length
Description : The use of EYFP as a photoswitchable emitter vastly expands the number of biological specimens immediately available for super-resolution imaging.
Form : Lyophilized powder, slight yellow
Molecular Mass : Recombinant protein has a calculated molecular weight of about 30 kDa.
AA Sequence : MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Purity : > 95%
Applications : Protein-protein Interaction, Post-translational Modifications, ELISA, EIA, Western Blotting, Dot Blotting, Immunoprecipitation, Protein Array, etc.
Notes : This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.
Storage : Upon arrival, the lyophilized protein may be stored for 2 weeks at 4 centigrade. For long term storage, it is recommended to store desiccated below -20 centigrade in a manual defrost freezer. Following reconstitution, the protein may be stored for 2 weeks under sterile conditions at -20 centigrade. For long term storage, it is recommended to make appropriate aliquots and store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Reconstitution : Briefly spin the vial and bring the contents to the bottom prior to opening. It is recommended to reconstitute at 0.5 - 1 mg/mL with sterile deionized water.
Shipping : Ice packs
Official Symbol EYFP
Synonyms EYFP; Enhanced Yellow Fluorescent Protein; Yellow Fluorescent Protein; YFP

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EYFP Products

Required fields are marked with *

My Review for All EYFP Products

Required fields are marked with *

0
cart-icon