Recombinant Enhanced Yellow Fluorescent Protein (Full length), N-His-tagged

• Cat.No.: EYFP-12
• Product Overview: Recombinant enhanced yellow fluorescent protein with a N-terminal histidine tag was expressed in Human Embryonic Kidney 293 Cells.

Specification

• Source: HEK293
• Tag: His
• Protein Length: Full length
• Description: The use of EYFP as a photoswitchable emitter vastly expands the number of biological specimens immediately available for super-resolution imaging.
• Form: Lyophilized powder, slight yellow
• Molecular Mass: Recombinant protein has a calculated molecular weight of about 30 kDa.
• AA Sequence: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
• Purity: > 95%
• Applications: Protein-protein Interaction, Post-translational Modifications, ELISA, EIA, Western Blotting, Dot Blotting, Immunoprecipitation, Protein Array, etc.
• Notes: This product is furnished for LABORATORY RESEARCH USE ONLY.
  Not for diagnostic or therapeutic use.
• Storage: Upon arrival, the lyophilized protein may be stored for 2 weeks at 4 centigrade. For long term storage, it is recommended to store desiccated below -20 centigrade in a manual defrost freezer. Following reconstitution, the protein may be stored for 2 weeks under sterile conditions at -20 centigrade. For long term storage, it is recommended to make appropriate aliquots and store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Reconstitution: Briefly spin the vial and bring the contents to the bottom prior to opening. It is recommended to reconstitute at 0.5 - 1 mg/mL with sterile deionized water.
• Shipping: Ice packs

Gene Information

• Official Symbol: EYFP
• Synonyms: EYFP; Enhanced Yellow Fluorescent Protein; Yellow Fluorescent Protein; YFP