Recombinant Arabidopsis Thaliana DRB5 Protein (1-393 aa), His-tagged

Cat.No. : DRB5-1841A
Product Overview : Recombinant Arabidopsis Thaliana (Mouse-ear cress) DRB5 Protein (1-393 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Arabidopsis Thaliana
Source : Yeast
Tag : His
Protein Length : 1-393 aa
Description : Binds double-stranded RNA. May be involved in RNA-mediated silencing.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 45.6 kDa
AA Sequence : MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESPTYCSTLRQAEHAAAEVSLNVLSSRVPSKSLTAKILDETGIYKNLLQETAHRAGLDLPMYTSVRSGSCHFPGFSCTVELAGMTFTGESAKTKKQAEKNAAIAAWSSLKKMSSLDSQDEEKEQEAVARVLSRFKPKEVRRRETTNQWRRRTSQQDSNKDLLIERLRWINLLTNQASSSSSTSTPNQHKNSSFISLIPPPPPPKSSKILPFIQQYKDRSSQEAKTETATEMINSKAKVNETSTRLSKQMPFSDMNRYNFVGGCSVNPYSLAPAVQMRSVIPVFAAPPPKPNPNLNPSSLSSSVNEFTSSNNSCSVLNTPGLGGQEKKNLTREMIKLGSESRILDQTHDS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name DRB5 dsRNA-binding protein 5 [ Arabidopsis thaliana (thale cress) ]
Official Symbol DRB5
Synonyms dsRNA-binding protein 5; MEE6.14; MEE6_14;
Gene ID 834109
mRNA Refseq NM_123472
Protein Refseq NP_198923
UniProt ID Q8GY79

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DRB5 Products

Required fields are marked with *

My Review for All DRB5 Products

Required fields are marked with *

0
cart-icon
0
compare icon