Recombinant Arabidopsis Thaliana LCR83 Protein (28-82 aa), GST-tagged
| Cat.No. : | LCR83-1563A |
| Product Overview : | Recombinant Arabidopsis Thaliana (Mouse-ear cress) LCR83 Protein (28-82 aa) is produced by Yeast expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Arabidopsis Thaliana |
| Source : | Yeast |
| Tag : | GST |
| Protein Length : | 28-82 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 32.9 kDa |
| AA Sequence : | NFASGEASSQLCFNPCTPQLGNNECNTICMNKKYKEGSCVGFGIPPTSKYCCCKT |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | LCR83 low-molecular-weight cysteine-rich 83 [ Arabidopsis thaliana (thale cress) ] |
| Official Symbol | LCR83 |
| Synonyms | low-molecular-weight cysteine-rich 83; |
| Gene ID | 3771507 |
| mRNA Refseq | NM_001036997 |
| Protein Refseq | NP_001032074 |
| UniProt ID | P82792 |
| ◆ Recombinant Proteins | ||
| LCR83-1563A | Recombinant Arabidopsis Thaliana LCR83 Protein (28-82 aa), GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LCR83 Products
Required fields are marked with *
My Review for All LCR83 Products
Required fields are marked with *




