Recombinant Arthrobacter Globiformis UOX Protein (11-297 aa), His-tagged
Cat.No. : | UOX-1553A |
Product Overview : | Recombinant Arthrobacter Globiformis UOX Protein (11-297 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arthrobacter Globiformis |
Source : | Yeast |
Tag : | His |
Protein Length : | 11-297 aa |
Description : | Catalyzes the oxidation of uric acid to 5-hydroxyisourate, which is further processed to form (S)-allantoin. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 34.4 kDa |
AA Sequence : | TKVVLGQNQYGKAEVRLVKVTRNTARHEIQDLNVTSQLRGDFEAAHTAGDNAHVVATDTQKNTVYAFARDGFATTEEFLLRLGKHFTEGFDWVTGGRWAAQQFFWDRINDHDHAFSRNKSEVRTAVLEISGSEQAIVAGIEGLTVLKSTGSEFHGFPRDKYTTLQETTDRILATDVSARWRYNTVEVDFDAVYASVRGLLLKAFAETHSLALQQTMYEMGRAVIETHPEIDEIKMSLPNKHHFLVDLQPFGQDNPNEVFYAADRPYGLIEATIQREGSRADHPIWSN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | uox; Urate oxidase Short name: AgUOX; |
UniProt ID | D0VWQ1 |
◆ Recombinant Proteins | ||
UOX-80H | Active Recombinant Urate Oxidase | +Inquiry |
UOX-1553A | Recombinant Arthrobacter Globiformis UOX Protein (11-297 aa), His-tagged | +Inquiry |
UOX-01H | Recombinant Human UOX Protein | +Inquiry |
UOX-6454R | Recombinant Rat UOX Protein | +Inquiry |
UOX-84H | Recombinant Urate Oxidase (Pseudogene) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UOX Products
Required fields are marked with *
My Review for All UOX Products
Required fields are marked with *
0
Inquiry Basket