Recombinant Pig UOX Protein (1-304 aa), His-SUMO-tagged
Cat.No. : | UOX-2046P |
Product Overview : | Recombinant Pig UOX Protein (1-304 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-304 aa |
Description : | Catalyzes the oxidation of uric acid to 5-hydroxyisourate, which is further processed to form (S)-allantoin. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 51.0 kDa |
AA Sequence : | MAHYRNDYKKNDEVEFVRTGYGKDMIKVLHIQRDGKYHSIKEVATSVQLTLSSKKDYLHGDNSDVIPTDTIKNTVNVLAKFKGIKSIETFAVTICEHFLSSFKHVIRAQVYVEEVPWKRFEKNGVKHVHAFIYTPTGTHFCEVEQIRNGPPVIHSGIKDLKVLKTTQSGFEGFIKDQFTTLPEVKDRCFATQVYCKWRYHQGRDVDFEATWDTVRSIVLQKFAGPYDKGEYSPSVQKTLYDIQVLTLGQVPEIEDMEISLPNIHYLNIDMSKMGLINKEEVLLPLDNPYGRITGTVKRKLTSRL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | UOX urate oxidase [ Sus scrofa (pig) ] |
Official Symbol | UOX |
Synonyms | UOX; Urate oxidase; |
Gene ID | 397510 |
mRNA Refseq | NM_214270 |
Protein Refseq | NP_999435 |
UniProt ID | P16164 |
◆ Recombinant Proteins | ||
UOX-1553A | Recombinant Arthrobacter Globiformis UOX Protein (11-297 aa), His-tagged | +Inquiry |
UOX-6454R | Recombinant Rat UOX Protein | +Inquiry |
UOX-9925M | Recombinant Mouse UOX Protein, His (Fc)-Avi-tagged | +Inquiry |
UOX-2046P | Recombinant Pig UOX Protein (1-304 aa), His-SUMO-tagged | +Inquiry |
UOX-01H | Recombinant Human UOX Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UOX Products
Required fields are marked with *
My Review for All UOX Products
Required fields are marked with *
0
Inquiry Basket