Recombinant Artificial EGFP (Full Length), His-tagged, Biotinylated

Cat.No. : EGFP-17
Product Overview : Recombinant Biotinylated Artificial sequence Enhanced Green Fluorescent protein with a His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : HEK293
Tag : His
Form : Lyophilized powder
Molecular Mass : Recombinant protein has a calculated molecular weight of about 30 kDa.
AA Sequence : MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Endotoxin : Not determined
Purity : >95%
Applications : Functional Assay, Protein-protein Interaction, Post-translational Modifications, ELISA, EIA, Western Blotting, Dot Blotting, Immunoprecipitation, Protein Array, etc.
Notes : This product is furnished for LABORATORY RESEARCH USE ONLY. Not for diagnostic or therapeutic use.
Storage : Upon arrival, the lyophilized protein may be stored for 2 weeks at 4 centigrade. For long term storage, it is recommended to store desiccated below -20 centigrade in a manual defrost freezer. Following reconstitution, the protein may be stored for 2 weeks under sterile conditions at -20 centigrade. For long term storage, it is recommended to make appropriate aliquots and store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Storage Buffer : Lyophilized from a 0.2 μm filtered solution in PBS
Reconstitution : Briefly spin the vial and bring the contents to the bottom prior to opening. It is recommended to reconstitute at 0.5-1 mg/mL with sterile deionized water.
Shipping : Ice packs
Conjugation : Biotin
Official Symbol EGFP
Synonyms Enhanced green fluorescent protein; EGFP

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EGFP Products

Required fields are marked with *

My Review for All EGFP Products

Required fields are marked with *

0
cart-icon