Recombinant Aspergillus giganteus afp protein, His-B2M-tagged
| Cat.No. : | afp-3937A |
| Product Overview : | Recombinant Aspergillus giganteus afp protein(P17737)(44-94aa), fused to N-terminal His-B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Aspergillus giganteus |
| Source : | E.coli |
| Tag : | B2M&His |
| Protein Length : | 44-94aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 19.8 kDa |
| AA Sequence : | ATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| AFP-545H | Recombinant Human AFP Protein, MYC/DDK-tagged | +Inquiry |
| AFP-4180H | Purified Human Alpha-Fetoprotein | +Inquiry |
| Afp-122M | Recombinant Mouse Afp Protein, His-tagged | +Inquiry |
| AFP-379M | Recombinant Mouse AFP Protein, His (Fc)-Avi-tagged | +Inquiry |
| aFP-3365P | Recombinant Pig aFP, His-tagged, GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| AFP-412H | Native Human AFP Protein | +Inquiry |
| AFP-1180H | Native Human Alpha-Fetoprotein | +Inquiry |
| AFP-8027H | Native Human Alpha FetoProtein | +Inquiry |
| AFP-3017H | Native Human fetal cord serum | +Inquiry |
| AFP-3018P | Native pig AFP | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AFP-1706HCL | Recombinant Human AFP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All afp Products
Required fields are marked with *
My Review for All afp Products
Required fields are marked with *
