Recombinant Aspergillus Kawachii EGLD Protein (21-408 aa), His-tagged
Cat.No. : | EGLD-2435A |
Product Overview : | Recombinant Aspergillus Kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi) EGLD Protein (21-408 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aspergillus Kawachii |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-408 aa |
Description : | Has endoglucanase activity on substrates containing beta-1,4 glycosidic bonds, like in carboxymethylcellulose (CMC), hydroxyethylcellulose (HEC) and beta-glucan. Involved in the degradation of complex natural cellulosic substrates. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 45.2 kDa |
AA Sequence : | HTTVQAVWINGEDQGLGNTDDGYIRSPPSNSPVTDVTSTDMTCNVNGDQAASKTLSVKAGDVVTFEWHHSDRSDSDDIIASSHKGPVQVYMAPTAKGSNGNNWVKIAEDGYHKSSDEWATDILIANKGKHNITVPDVPAGNYLFRPEIIALHEGNREGGAQFYMECVQFKVTSDGSNELPSGVSIPGVYTATDPGILFDIYNSFDSYPIPGPDVWDGSSSGSSSSGSSSAAVSSAAAAATTSAVAATTPATQAAVEVSSSAAAATTEAAAPVVSSAAPVQQATSAVTSQAQAAPTTFATSSKKSSKTACKNKTKSNSQVAAATSSVVAPAATSSVVPVVSASASASAGGVAKQYERCGGINHTGPTTCESGSVCKKWNPYYYQCVASQ |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Synonyms | eglD; |
UniProt ID | Q96WQ9 |
◆ Recombinant Proteins | ||
eglD-5803W | Recombinant White koji mold eglD protein, His-sumostar-tagged | +Inquiry |
EGLD-2423A | Recombinant Aspergillus Kawachii EGLD Protein (21-408 aa), His-tagged | +Inquiry |
EGLD-2435A | Recombinant Aspergillus Kawachii EGLD Protein (21-408 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGLD Products
Required fields are marked with *
My Review for All EGLD Products
Required fields are marked with *
0
Inquiry Basket