Recombinant Azotobacter Vinelandii ALGL Protein (24-374 aa), His-SUMO-Myc-tagged
Cat.No. : | ALGL-2178A |
Product Overview : | Recombinant Azotobacter Vinelandii ALGL Protein (24-374 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Azotobacter Vinelandii |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 24-374 aa |
Description : | Catalyzes the depolymerization of alginate by cleaving the beta-1,4 glycosidic bond between two adjacent sugar residues via a beta-elimination mechanism. Splits ManA-ManA and ManA-GulA bonds, but not GulA-ManA or GulA-GulA bonds. Also cleaves acetylated residues. May serve to degrade mislocalized alginate that is trapped in the periplasmic space. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 59.0 kDa |
AA Sequence : | AEALVPPKGYYAPVDIRKGEAPACPVVPEPFTGELVFRSKYEGSDAARSTLNEEAEKAFRTKTAPITQIERGVSRMVMRYMEKGRAGDLECTLAWLDAWAEDGALLTTEYNHTGKSMRKWALGSLAGAYLRLKFSSSQPLAAYPEQARRIESWFAKVGDQVIKDWSDLPLKRINNHSYWAAWAVMAAGVATNRRPLFDWAVEQFHIAAGQVDSNGFLPNELKRRQRALAYHNYSLPPLMMVAAFALANGVDLRGDNDGALGRLAGNVLAGVEKPEPFAERAGDEDQDMEDLETDAKFSWLEPYCALYSCSPALRERKAEMGPFKNFRLGGDVTRIFDPAEKSPRSTVGKRD |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Synonyms | algL; Poly(beta-D-mannuronate) lyase; |
UniProt ID | O52195 |
◆ Recombinant Proteins | ||
algL-0222P | Recombinant Pseudomonas fluorescens algL protein(26-373aa), His&Myc-tagged | +Inquiry |
ALGL-2178A | Recombinant Azotobacter Vinelandii ALGL Protein (24-374 aa), His-SUMO-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALGL Products
Required fields are marked with *
My Review for All ALGL Products
Required fields are marked with *
0
Inquiry Basket