Recombinant Azotobacter Vinelandii ALGL Protein (24-374 aa), His-SUMO-Myc-tagged

Cat.No. : ALGL-2178A
Product Overview : Recombinant Azotobacter Vinelandii ALGL Protein (24-374 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Azotobacter Vinelandii
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 24-374 aa
Description : Catalyzes the depolymerization of alginate by cleaving the beta-1,4 glycosidic bond between two adjacent sugar residues via a beta-elimination mechanism. Splits ManA-ManA and ManA-GulA bonds, but not GulA-ManA or GulA-GulA bonds. Also cleaves acetylated residues. May serve to degrade mislocalized alginate that is trapped in the periplasmic space.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 59.0 kDa
AA Sequence : AEALVPPKGYYAPVDIRKGEAPACPVVPEPFTGELVFRSKYEGSDAARSTLNEEAEKAFRTKTAPITQIERGVSRMVMRYMEKGRAGDLECTLAWLDAWAEDGALLTTEYNHTGKSMRKWALGSLAGAYLRLKFSSSQPLAAYPEQARRIESWFAKVGDQVIKDWSDLPLKRINNHSYWAAWAVMAAGVATNRRPLFDWAVEQFHIAAGQVDSNGFLPNELKRRQRALAYHNYSLPPLMMVAAFALANGVDLRGDNDGALGRLAGNVLAGVEKPEPFAERAGDEDQDMEDLETDAKFSWLEPYCALYSCSPALRERKAEMGPFKNFRLGGDVTRIFDPAEKSPRSTVGKRD
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Synonyms algL; Poly(beta-D-mannuronate) lyase;
UniProt ID O52195

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALGL Products

Required fields are marked with *

My Review for All ALGL Products

Required fields are marked with *

0
cart-icon