Recombinant Pseudomonas fluorescens algL protein(26-373aa), His&Myc-tagged
Cat.No. : | algL-0222P |
Product Overview : | Recombinant Pseudomonas fluorescens algL protein(P59786)(26-373aa), fused with N-terminal His and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas fluorescens |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 26-373aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.1 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | AAPLRPPQGYFAPVEAFKTGDFKNDCDAMPPPYTGSLQFRSKYEGSDKARSTLNVQSEKAFRDSTADITKLEKDTSKRVMQFMRDGRPEQLECTLNWLTSWAKADALMSKDFNHTGKSMRKWALGSMASAYVRLKFSDSHPLANHQQESQLIEAWFNKLADQVVSDWDNLPLEKTNNHSYWAAWSVMATSVATNRRDLFDWAVKEYKVGVNQVDDQGFLPNELKRQQRALSYHNYALPPLSMIASFALVNGVDLRQENNSALKRLGDKVLAGVKDPEIFEKKNGKEQDMKDLKEDMKYAWLEPFCTLYTCAPDVIERKHGMQPFKTFRLGGDLTKVYDPTHEKGNKGS |
◆ Recombinant Proteins | ||
ALGL-2178A | Recombinant Azotobacter Vinelandii ALGL Protein (24-374 aa), His-SUMO-Myc-tagged | +Inquiry |
algL-0222P | Recombinant Pseudomonas fluorescens algL protein(26-373aa), His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All algL Products
Required fields are marked with *
My Review for All algL Products
Required fields are marked with *