Recombinant Bacillus Thuringiensis Subsp. Morrisoni CRY1FB Protein (984-1159 aa), His-tagged
Cat.No. : | CRY1FB-1646P |
Product Overview : | Recombinant Bacillus Thuringiensis Subsp. Morrisoni CRY1FB Protein (984-1159 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus thuringiensis |
Source : | Yeast |
Tag : | His |
Protein Length : | 984-1159 aa |
Description : | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of insects. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 21.6 kDa |
AA Sequence : | VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIV |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | cry1Fb; 132 kDa crystal protein Crystaline entomocidal protoxin Insecticidal delta-endotoxin CryIF(b); |
UniProt ID | O66377 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRY1FB Products
Required fields are marked with *
My Review for All CRY1FB Products
Required fields are marked with *