Recombinant Bacillus Thuringiensis Subsp. Morrisoni CRY1FB Protein (984-1169 aa), GST-tagged
| Cat.No. : | CRY1FB-995B |
| Product Overview : | Recombinant Bacillus Thuringiensis Subsp. Morrisoni CRY1FB Protein (984-1169 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bacillus thuringiensis |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 984-1169 aa |
| Description : | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of insects. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 47.8 kDa |
| AA Sequence : | VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIVDSVELLLMEE |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| UniProt ID | O66377 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRY1FB Products
Required fields are marked with *
My Review for All CRY1FB Products
Required fields are marked with *
