Recombinant Baker's yeast ULP1 protein, His-tagged
| Cat.No. : | ULP1-3807B | 
| Product Overview : | Recombinant Baker's yeast ULP1 protein(Q02724)(403-621aa), fused to N-terminal His tag, was expressed in E. coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Yeast | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 403-621aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.  | 
                                
| Molecular Mass : | 27.9 kDa | 
| AA Sequence : | LVPRGSHMASLVPELNEKDDDQVQKALASRENTQLMNRDNIEITVRDFKTLAPRRWLNDTIIEFFMKYIEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDCGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALK | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. | 
| ◆ Recombinant Proteins | ||
| ULP1-02S | Active Recombinant Saccharomyces cerevisiae ULP1 Protein | +Inquiry | 
| ULP1-1571S | Recombinant S. cerevisiae ULP1 protein | +Inquiry | 
| ULP1-3807B | Recombinant Baker's yeast ULP1 protein, His-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All ULP1 Products
Required fields are marked with *
My Review for All ULP1 Products
Required fields are marked with *
  
        
    
      
            