Recombinant Bartonella Henselae LIPA Protein (1-320 aa), His-tagged
Cat.No. : | LIPA-2402B |
Product Overview : | Recombinant Bartonella Henselae (strain ATCC 49882/DSM 28221/Houston 1) (Rochalimaea henselae) LIPA Protein (1-320 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bartonella Henselae |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-320 aa |
Description : | Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 38.7 kDa |
AA Sequence : | MVTVVDRVTDRRLRHPEKAHRPDTSVQKKPDWIRVKAPTSQVYKETHGIVRAHKLVTVCEEAGCPNIGECWSQRHASFMILGEICTRACAFCNVATGIPFAVDENEPERVADAVARMELKHVVITSVDRDDLADGGAEHFAKVIYAIRRKAPKTTIEVLTPDFRHKDGALEIVVAAKPDVFNHNLETVPSKYLKVRPGARYFHSIRLLQRVKELDPTIFTKSGIMVGLGEERNEILQLMDDLRSADVDFMTIGQYLQPTRKHHPVIRFVPPEEFESFAKIGKVKGFLHMASNPLTRSSHHAGDDFAILQKARDEKFALQR |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Synonyms | lipA; |
UniProt ID | Q6G401 |
◆ Recombinant Proteins | ||
LIPA-2343R | Recombinant Rhesus Macaque LIPA Protein, His (Fc)-Avi-tagged | +Inquiry |
Lipa-1171R | Recombinant Rat Lipa protein, His-tagged | +Inquiry |
LIPA-2523R | Recombinant Rhesus monkey LIPA Protein, His-tagged | +Inquiry |
LIPA-7697HFL | Recombinant Full Length Human LIPA, Flag-tagged | +Inquiry |
LIPA-6304H | Recombinant Human LIPA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIPA-4727HCL | Recombinant Human LIPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LIPA Products
Required fields are marked with *
My Review for All LIPA Products
Required fields are marked with *
0
Inquiry Basket