| Species : | 
                                    Human | 
                                
                                
                                    | Source : | 
                                    Yeast | 
                                
                                
                                    | Tag : | 
                                    His | 
                                
                                
                                    | Protein Length : | 
                                    22-399 aa | 
                                
                                
                                    | Description : | 
                                    Crucial for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles. Important in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation. | 
                                
                                
                                    | Form : | 
                                    Tris-based buffer,50% glycerol | 
                                
                                
                                    | Molecular Mass : | 
                                    45.0 kDa | 
                                
                                
                                    | AA Sequence : | 
                                    SGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ | 
                                
                                
                                    | Purity : | 
                                    > 90% as determined by SDS-PAGE. | 
                                
                                
                                    | Notes : | 
                                    Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. | 
                                
                                
                                    | Storage : | 
                                    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. | 
                                
                                
                                    | Concentration : | 
                                    A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |