Recombinant Bovine APOA1 protein, His-tagged
Cat.No. : | APOA1-2530B |
Product Overview : | Recombinant Bovine APOA1 protein(P15497)(25-265aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-265aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.6 kDa |
AA Sequence : | DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
APOA1-2478H | Recombinant Human APOA1 Protein, MYC/DDK-tagged | +Inquiry |
APOA1-53C | Recombinant Cynomolgus Monkey APOA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
APOA1-689H | Recombinant Human APOA1 protein, GST-tagged | +Inquiry |
APOA1-699H | Recombinant Human APOA1 protein | +Inquiry |
APOA1-2530B | Recombinant Bovine APOA1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ApoA-I-3554H | Native Human ApoA-I | +Inquiry |
APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
APOA1-8034H | Native Human ApoLipoprotein | +Inquiry |
APOA1-26121TH | Native Human APOA1, Protein A-tagged | +Inquiry |
APOA1-8344H | Native Human APOA1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOA1-1497MCL | Recombinant Mouse APOA1 cell lysate | +Inquiry |
APOA1-3088HCL | Recombinant Human APOA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOA1 Products
Required fields are marked with *
My Review for All APOA1 Products
Required fields are marked with *