Recombinant Mouse Apoa1 protein, His&Myc-tagged
| Cat.No. : | Apoa1-545M |
| Product Overview : | Recombinant Mouse Apoa1 protein(Q00623)(19-264aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 19-264aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 36.3 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | WHVWQQDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDKASETLTAQ |
| Gene Name | Apoa1 apolipoprotein A-I [ Mus musculus ] |
| Official Symbol | Apoa1 |
| Synonyms | APOA1; apolipoprotein A-I; apo-AI; apoA-I; apolipoprotein A1; Sep2; Alp-1; Ltw-1; Sep-1; Sep-2; Apoa-1; Brp-14; Lvtw-1; MGC102525; |
| Gene ID | 11806 |
| mRNA Refseq | NM_009692 |
| Protein Refseq | NP_033822 |
| ◆ Recombinant Proteins | ||
| APOA1-205P | Recombinant Pig APOA1 Protein, His-tagged | +Inquiry |
| APOA1-2594H | Recombinant Human APOA1 protein | +Inquiry |
| APOA1-4958C | Recombinant Chimpanzee APOA1 protein, His-tagged | +Inquiry |
| APOA1-2478H | Recombinant Human APOA1 Protein, MYC/DDK-tagged | +Inquiry |
| APOA1-357H | Recombinant Human APOA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| APOA1-8344H | Native Human APOA1 | +Inquiry |
| APOA1-26121TH | Native Human APOA1, Protein A-tagged | +Inquiry |
| APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
| APOA1-5301H | Native Human Apolipoprotein A-I | +Inquiry |
| APOA1-256H | Native Human APOA1 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APOA1-1497MCL | Recombinant Mouse APOA1 cell lysate | +Inquiry |
| APOA1-3088HCL | Recombinant Human APOA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Apoa1 Products
Required fields are marked with *
My Review for All Apoa1 Products
Required fields are marked with *
