Recombinant Mouse Apoa1 protein, His&Myc-tagged
Cat.No. : | Apoa1-545M |
Product Overview : | Recombinant Mouse Apoa1 protein(Q00623)(19-264aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 19-264aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | WHVWQQDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDKASETLTAQ |
Gene Name | Apoa1 apolipoprotein A-I [ Mus musculus ] |
Official Symbol | Apoa1 |
Synonyms | APOA1; apolipoprotein A-I; apo-AI; apoA-I; apolipoprotein A1; Sep2; Alp-1; Ltw-1; Sep-1; Sep-2; Apoa-1; Brp-14; Lvtw-1; MGC102525; |
Gene ID | 11806 |
mRNA Refseq | NM_009692 |
Protein Refseq | NP_033822 |
◆ Recombinant Proteins | ||
APOA1-217H | Recombinant Human APOA1, C13&N15-labeled | +Inquiry |
APOA1-357H | Recombinant Human APOA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
APOA1-2594H | Recombinant Human APOA1 protein | +Inquiry |
APOA1-2478H | Recombinant Human APOA1 Protein, MYC/DDK-tagged | +Inquiry |
Apoa1-631M | Recombinant Mouse Apoa1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
APOA1-26121TH | Native Human APOA1, Protein A-tagged | +Inquiry |
APOA1-5301H | Native Human Apolipoprotein A-I | +Inquiry |
APOA1-8034H | Native Human ApoLipoprotein | +Inquiry |
ApoA-I-3554H | Native Human ApoA-I | +Inquiry |
APOA1-256H | Native Human APOA1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOA1-3088HCL | Recombinant Human APOA1 cell lysate | +Inquiry |
APOA1-1497MCL | Recombinant Mouse APOA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Apoa1 Products
Required fields are marked with *
My Review for All Apoa1 Products
Required fields are marked with *