Recombinant Bovine ARRB2 protein, His-GST-tagged
Cat.No. : | ARRB2-631B |
Product Overview : | Recombinant Bovine ARRB2 protein(P32120)(240-420aa), fused with N-terminal His and GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 240-420aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 51.5 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ADICLFSTAQYKCPVAQVEQDDQVSPSSTFCKVYTITPLLSNNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIALPRPQSAATHPPTLLPSAVPETDAPVDTNLIEFETNYATDDDIVFEDFARLRLKGLKDEDYDDQFC |
◆ Recombinant Proteins | ||
ARRB2-631B | Recombinant Bovine ARRB2 protein, His-GST-tagged | +Inquiry |
ARRB2-855H | Recombinant Human ARRB2 protein, GST-tagged | +Inquiry |
ARRB2-803R | Recombinant Rat ARRB2 Protein | +Inquiry |
ARRB2-9893H | Recombinant Human ARRB2, GST-tagged | +Inquiry |
ARRB2-459R | Recombinant Rat ARRB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARRB2-130HCL | Recombinant Human ARRB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARRB2 Products
Required fields are marked with *
My Review for All ARRB2 Products
Required fields are marked with *
0
Inquiry Basket