Recombinant Bovine CSN2 protein, His&Myc-tagged
Cat.No. : | CSN2-2744B |
Product Overview : | Recombinant Bovine CSN2 protein(P02666)(16-224aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 16-224aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 28.6 kDa |
AA Sequence : | RELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
CSN2-2019M | Recombinant Mouse CSN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CSN2-1835H | Recombinant Human CSN2 Protein (His41-Leu198), N-His tagged | +Inquiry |
CSN2-2752C | Recombinant Cattle CSN2 Protein, His-tagged | +Inquiry |
CSN2-2744B | Recombinant Bovine CSN2 protein, His&Myc-tagged | +Inquiry |
CSN2-3971M | Recombinant Mouse CSN2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSN2-7244HCL | Recombinant Human CSN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSN2 Products
Required fields are marked with *
My Review for All CSN2 Products
Required fields are marked with *