Recombinant Bovine IGF2R protein, His-tagged
| Cat.No. : | IGF2R-5224B |
| Product Overview : | Recombinant Bovine IGF2R protein(P08169)(628-772aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 628-772aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 22.4 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP |
| ◆ Recombinant Proteins | ||
| IGF2R-625H | Active Recombinant Human IGF2R, Fc-tagged, Biotinylated | +Inquiry |
| IGF2R-5224B | Recombinant Bovine IGF2R protein, His-tagged | +Inquiry |
| IGF2R-344H | Recombinant Human IGF2R protein, His-Avi-tagged | +Inquiry |
| IGF2R-3140H | Recombinant Human IGF2R Protein, His (Fc)-Avi-tagged | +Inquiry |
| IGF2R-290H | Recombinant Human IGF2R protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF2R Products
Required fields are marked with *
My Review for All IGF2R Products
Required fields are marked with *
