Recombinant Bovine IGF2R protein, His-tagged
| Cat.No. : | IGF2R-5224B | 
| Product Overview : | Recombinant Bovine IGF2R protein(P08169)(628-772aa), fused with N-terminal His tag, was expressed in E.coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 628-772aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 22.4 kDa | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. | 
| AA Sequence : | LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP | 
| ◆ Recombinant Proteins | ||
| IGF2R-2324B | Recombinant Bovine IGF2R protein | +Inquiry | 
| IGF2R-2639H | Recombinant Human IGF2R protein(501-580 aa), C-His-tagged | +Inquiry | 
| IGF2R-626H | Active Recombinant Human IGF2R, Fc-tagged | +Inquiry | 
| IGF2R-341H | Recombinant Human IGF2R protein, His-Avi-tagged | +Inquiry | 
| IGF2R-627H | Active Recombinant Human IGF2R protein, Fc-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF2R Products
Required fields are marked with *
My Review for All IGF2R Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            