Recombinant Bovine LHB Protein (21-141 aa), His-tagged
| Cat.No. : | LHB-622B |
| Product Overview : | Recombinant Bovine LHB Protein (21-141 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 21-141 aa |
| Description : | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 17.0 kDa |
| AA Sequence : | SRGPLRPLCQPINATLAAEKEACPVCITFTTSICAGYCPSMKRVLPVILPPMPQRVCTYHELRFASVRLPGCPPGVDPMVSFPVALSCHCGPCRLSSTDCGGPRTQPLACDHPPLPDILFL |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | LHB luteinizing hormone beta polypeptide [ Bos taurus (cattle) ] |
| Official Symbol | LHB |
| Gene ID | 280839 |
| mRNA Refseq | NM_173930 |
| Protein Refseq | NP_776355 |
| UniProt ID | P04651 |
| ◆ Recombinant Proteins | ||
| Lhb-7910R | Recombinant Rat Lhb protein, His-tagged | +Inquiry |
| LHB-652C | Recombinant Cynomolgus LHB Protein, His-tagged | +Inquiry |
| Lhb-1316M | Recombinant Mouse Lhb Protein, MYC/DDK-tagged | +Inquiry |
| LHB-3173D | Recombinant Dog LHB protein, His-tagged | +Inquiry |
| LHB-622B | Recombinant Bovine LHB Protein (21-141 aa), His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| LHB-8212H | Native Luteinizing Beta Subunit Hormone | +Inquiry |
| LHB-840 | Native Luteinizing Hormone, beta Subunit | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LHB-1522HCL | Recombinant Human LHB Overexpression Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LHB Products
Required fields are marked with *
My Review for All LHB Products
Required fields are marked with *



