Recombinant Bovine LHB Protein (21-141 aa), His-tagged
Cat.No. : | LHB-622B |
Product Overview : | Recombinant Bovine LHB Protein (21-141 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-141 aa |
Description : | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 17.0 kDa |
AA Sequence : | SRGPLRPLCQPINATLAAEKEACPVCITFTTSICAGYCPSMKRVLPVILPPMPQRVCTYHELRFASVRLPGCPPGVDPMVSFPVALSCHCGPCRLSSTDCGGPRTQPLACDHPPLPDILFL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | LHB luteinizing hormone beta polypeptide [ Bos taurus (cattle) ] |
Official Symbol | LHB |
Gene ID | 280839 |
mRNA Refseq | NM_173930 |
Protein Refseq | NP_776355 |
UniProt ID | P04651 |
◆ Recombinant Proteins | ||
LHB-1511H | Recombinant Human LHB Protein, MYC/DDK-tagged | +Inquiry |
LHB-2831H | Recombinant Human LHB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Lhb-7910R | Recombinant Rat Lhb protein, His-tagged | +Inquiry |
lhb-2739Z | Recombinant Zebrafish lhb Protein, His-tagged | +Inquiry |
LHB-1091H | Recombinant Human LHB Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LHB-840 | Native Luteinizing Hormone, beta Subunit | +Inquiry |
LHB-8212H | Native Luteinizing Beta Subunit Hormone | +Inquiry |
◆ Cell & Tissue Lysates | ||
LHB-1522HCL | Recombinant Human LHB Overexpression Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LHB Products
Required fields are marked with *
My Review for All LHB Products
Required fields are marked with *
0
Inquiry Basket