Recombinant Bovine PRL protein, His-tagged
Cat.No. : | PRL-96B |
Product Overview : | Recombinant Bovine PRL protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation. Alternative splicing results in multiple transcript variants that encode the same protein. |
Form : | 50mM Tris, 300mM NaCl, pH 8.0. |
Molecular Mass : | 24 kDa |
AA Sequence : | MGSSHHHHHHTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGAPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.25 mg/ml |
Gene Name | PRL prolactin [ Bos taurus (cattle) ] |
Official Symbol | PRL |
Synonyms | GHA1 |
Gene ID | 280901 |
mRNA Refseq | NM_173953 |
Protein Refseq | NP_776378 |
UniProt ID | P01239 |
◆ Recombinant Proteins | ||
PRL-459H | Recombinant Human PRL protein, His-tagged | +Inquiry |
Prl-1982M | Recombinant Mouse Prl Protein, His-tagged | +Inquiry |
PRL-22O | Active Recombinant Ovine Prolactin / PRL Protein | +Inquiry |
PRL-2715H | Recombinant Human Prolactin | +Inquiry |
Prl-1651M | Recombinant Mouse Prl protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PRL-111S | Active Native Sheep Prolactin | +Inquiry |
PRL-8245H | Native Human Prolactin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRL-524MCL | Recombinant Mouse PRL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRL Products
Required fields are marked with *
My Review for All PRL Products
Required fields are marked with *