Recombinant Bovine PRL protein, His-tagged

Cat.No. : PRL-96B
Product Overview : Recombinant Bovine PRL protein, fused to His-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Bovine
Source : E.coli
Tag : His
Description : This gene encodes the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation. Alternative splicing results in multiple transcript variants that encode the same protein.
Form : 50mM Tris, 300mM NaCl, pH 8.0.
Molecular Mass : 24 kDa
AA Sequence : MGSSHHHHHHTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGAPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.25 mg/ml
Gene Name PRL prolactin [ Bos taurus (cattle) ]
Official Symbol PRL
Synonyms GHA1
Gene ID 280901
mRNA Refseq NM_173953
Protein Refseq NP_776378
UniProt ID P01239

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRL Products

Required fields are marked with *

My Review for All PRL Products

Required fields are marked with *

0
cart-icon
0
compare icon