Recombinant Bovine PRL protein, His-tagged
| Cat.No. : | PRL-96B |
| Product Overview : | Recombinant Bovine PRL protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His |
| Description : | This gene encodes the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation. Alternative splicing results in multiple transcript variants that encode the same protein. |
| Form : | 50mM Tris, 300mM NaCl, pH 8.0. |
| Molecular Mass : | 24 kDa |
| AA Sequence : | MGSSHHHHHHTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGAPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.25 mg/ml |
| Gene Name | PRL prolactin [ Bos taurus (cattle) ] |
| Official Symbol | PRL |
| Synonyms | GHA1 |
| Gene ID | 280901 |
| mRNA Refseq | NM_173953 |
| Protein Refseq | NP_776378 |
| UniProt ID | P01239 |
| ◆ Recombinant Proteins | ||
| Prl-5130M | Active Recombinant Mouse Prolactin / Prl Protein | +Inquiry |
| PRL-384H | Active Recombinant Human PRL protein, mFc-tagged | +Inquiry |
| PRL-3006H | Recombinant Full Length Human Prolactin Protein, MYC/DDK-tagged | +Inquiry |
| PRL-741P | Recombinant Pig PRL Protein (31-229 aa), His-SUMO-tagged | +Inquiry |
| PRL-7015C | Recombinant Chicken PRL | +Inquiry |
| ◆ Native Proteins | ||
| PRL-8245H | Native Human Prolactin | +Inquiry |
| PRL-111S | Active Native Sheep Prolactin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRL-524MCL | Recombinant Mouse PRL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRL Products
Required fields are marked with *
My Review for All PRL Products
Required fields are marked with *
