Recombinant Bovine PRNP Protein
Cat.No. : | PRNP-290B |
Product Overview : | Recombinant Bovine PRNP(24-241 aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | Non |
Protein Length : | 24-241 aa |
Description : | Prion Protein (PrP) is an abundant cellular protein in mammalian neural tissue. It is associated with mammalian prion diseases, e.g. transmissible spongiforme encephalophathies that include human Creutzfeld-Jakob disease, bovine spongiforme encephalopathy, sheep scrapie, cervid’s chronic wasting disease and various rodent prion diseases. In the disease process, PrP undergoes protein aggregation into disease specific PrPSc. |
Form : | Finally dialysed in pure water, shock frozen in liquid nitrogen at a protein concentration of 0.25 mg/ml. |
Molecular Mass : | 23163 kg/mol |
AA Sequence : | GSKKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGGWGQGGTHGQWNKPSKPKTNMKHVAGAAAAGAVVGGLGGYMLGSAMSRP LIHFGSDYEDRYYRENMHRYPNQVYYRPVDQYSNQNNFVHDCVNITVKEHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQRGA |
Purity : | > 95% by SDS-PAGE |
Applications : | Prion Protein is frequently used in analytical aggregation assays |
Notes : | Thawing: Gentle agitation at 37 centigrade until no ice is left. Keep on ice. Do not refreeze |
Storage : | Store at -80 centigrade |
Concentration : | 0.25 mg/ml |
Gene Name | PRNP prion protein [ Bos taurus ] |
Official Symbol | PRNP |
Synonyms | PrP; AltPrP; prion protein precursor PrP; prion protein variant a; prion protein variant b |
Gene ID | 281427 |
mRNA Refseq | NM_001271625 |
Protein Refseq | NP_001258554 |
UniProt ID | F7VJQ2 |
◆ Recombinant Proteins | ||
Prnp-802B | Recombinant Bovine Prion Protein (Q228R), His-tagged | +Inquiry |
PRNP-4367R | Recombinant Rat PRNP Protein, His (Fc)-Avi-tagged | +Inquiry |
PRP-01C | Recombinant Cervid PRNP Protein, His-tagged | +Inquiry |
Prnp-1064M | Recombinant Mouse Prion Protein, Globular Domain, His-tagged | +Inquiry |
Prnp-289M | Recombinant Mouse Prnp Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRNP-001HCL | Recombinant Human PRNP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRNP Products
Required fields are marked with *
My Review for All PRNP Products
Required fields are marked with *