Recombinant Cervid PRNP Protein, His-tagged
Cat.No. : | PRP-01C |
Product Overview : | Recombinant Cervid PRNP Protein with a His tag was expressed in E. coli. |
Availability | August 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cervid |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that tends to aggregate into rod-like structures. The encoded protein contains a highly unstable region of five tandem octapeptide repeats. This gene is found on chromosome 20, approximately 20 kbp upstream of a gene which encodes a biochemically and structurally similar protein to the one encoded by this gene. Mutations in the repeat region as well as elsewhere in this gene have been associated with Creutzfeldt-Jakob disease, fatal familial insomnia, Gerstmann-Straussler disease, Huntington disease-like 1, and kuru. An overlapping open reading frame has been found for this gene that encodes a smaller, structurally unrelated protein, AltPrp. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | ~ 17.3 kDa, reducing conditions |
AA Sequence : | MGGGWGQGGTHSQWNKPSKPKTNMKHVAGAAAAGAVVGGLGGYMLGSAMSRPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDQYNNQNTFVHDCVNITVKQHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQLEHHHHHH |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.11 mg/mL |
Storage Buffer : | Supplied as a 0.2 μm filtered solution in PBS, pH 8.0 |
Gene Name | PRNP prion protein [ Cervus canadensis ] |
Official Symbol | PRNP |
Synonyms | PRNP; prion protein; PrP; major prion protein; prion protein PrP |
Gene ID | 122448236 |
mRNA Refseq | XM_043479407 |
Protein Refseq | XP_043335342 |
UniProt ID | P79142 |
◆ Recombinant Proteins | ||
Prnp-289M | Recombinant Mouse Prnp Protein | +Inquiry |
PRNP-789H | Recombinant Human Prion Protein, His-tagged | +Inquiry |
PRNP-3435R | Recombinant Rhesus Macaque PRNP Protein, His (Fc)-Avi-tagged | +Inquiry |
Prnp-1064M | Recombinant Mouse Prion Protein, Globular Domain, His-tagged | +Inquiry |
Prnp-797O | Recombinant Ovine Prion Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRNP-001HCL | Recombinant Human PRNP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRNP Products
Required fields are marked with *
My Review for All PRNP Products
Required fields are marked with *