Recombinant Cervid PRNP Protein, His tagged
| Cat.No. : | PRP-01C |
| Product Overview : | Recombinant Cervid PRNP Protein with N-His tag was expressed in E.coli. |
| Availability | July 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cervid |
| Source : | E.coli |
| Tag : | His |
| Form : | Sterile PBS, pH8.0 |
| Molecular Mass : | 17 kDa |
| AASequence : | MGGGWGQGGTHSQWNKPSKPKTNMKHVAGAAAAGAVVGGLGGYMLGSAMSRPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDQYNNQNTFVHDCVNITVKQHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQLEHHHHHH |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.138 mg/mL by BCA |
| Gene Name | PRNP prion protein (Kanno blood group) [ Odocoileus virginianus (white-tailed deer) ] |
| Official Symbol | PRNP |
| Synonyms | PRNP; prion protein (Kanno blood group); PrP; AltPrP; major prion protein; alternative prion protein; prion protein PrP; prion protein precursor PrP |
| Gene ID | 110131178 |
| mRNA Refseq | XM_020883647 |
| Protein Refseq | XP_020739306 |
| UniProt ID | Q9MZU8 |
| ◆ Recombinant Proteins | ||
| Prnp-797O | Recombinant Ovine Prion Protein, His-tagged | +Inquiry |
| Prnp-799B | Recombinant Bovine Prion Protein, His-tagged | +Inquiry |
| PRNP-12HB | Recombinant Human PRNP Protein, Lys23-Ser230, C-His-Avi tagged, Biotinylated | +Inquiry |
| Prnp-01B | Recombinant Bos PRNP Protein, His-Tagged | +Inquiry |
| PRNP-742R | Recombinant Rat PRNP Protein (29-231 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRNP-001HCL | Recombinant Human PRNP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRNP Products
Required fields are marked with *
My Review for All PRNP Products
Required fields are marked with *
