Recombinant Cattle RETN Protein, His-tagged

Cat.No. : RETN-1351C
Product Overview : Recombinant Cattle RETN Protein (19-109aa) was expressed in E. coli with N-terminal His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cattle
Source : E.coli
Tag : His
Protein Length : 19-109 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 13.6 kDa
AA Sequence : QSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSLVTCPSGFAVTGCTCGSACGSWDVRAETT
CHCQCAGMDWTGARCCRLHIQ
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name RETN resistin [ Bos taurus (cattle) ]
Official Symbol RETN
Synonyms RETN; RSTN; resistin; adipocyte specific secreted hormone
Gene ID 369020
mRNA Refseq NM_183362.1
Protein Refseq NP_899206.1
UniProt ID Q762I5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RETN Products

Required fields are marked with *

My Review for All RETN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon