"RETN" Related Products

Expand
Expand
Expand

Recombinant Cattle RETN Protein, His-tagged

Cat.No. : RETN-1351C
Product Overview : Recombinant Cattle RETN Protein (19-109aa) was expressed in E. coli with N-terminal His tag.
Source : E. coli
Species : Cattle
Tag : His
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 13.6 kDa
AA Sequence : QSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSLVTCPSGFAVTGCTCGSACGSWDVRAETT
CHCQCAGMDWTGARCCRLHIQ
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Figure :

Gene Name : RETN resistin [ Bos taurus (cattle) ]
Official Symbol : RETN
Synonyms : RETN; RSTN; resistin; adipocyte specific secreted hormone
Gene ID : 369020
mRNA Refseq : NM_183362.1
Protein Refseq : NP_899206.1
UniProt ID : Q762I5

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.