Recombinant Chicken FGF2 protein, His-tagged
| Cat.No. : | FGF2-5632C |
| Product Overview : | Recombinant Chicken FGF2 protein(P48800)(13-158aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Chicken |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 13-158aa |
| Tag : | N-His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18.3 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS |
| ◆ Recombinant Proteins | ||
| FGF2-293H | Recombinant Human FGF2, StrepII-tagged | +Inquiry |
| FGF2-40B | Active Native Bovine FGF2 Protein | +Inquiry |
| Fgf2-061M | Active Recombinant Mouse Fgf2 Protein | +Inquiry |
| Fgf2-200R | Recombinant Rat Fgf2 protein, His/S-tagged | +Inquiry |
| Fgf2-13M | Recombinant Mouse Fgf2 Protein | +Inquiry |
| ◆ Native Proteins | ||
| FGF2-066D | Recombinant Duck FGF Basic Protein, Tag Free | +Inquiry |
| FGF2-046H | Active Recombinant Human FGF2 Protein | +Inquiry |
| FGF2-34B | Active Native Bovine bFGF | +Inquiry |
| FGF2-065C | Recombinant Chicken FGF Basic Protein, Tag Free | +Inquiry |
| FGF2-26551TH | Native Human FGF2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGF2-638HCL | Recombinant Human FGF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF2 Products
Required fields are marked with *
My Review for All FGF2 Products
Required fields are marked with *
