Recombinant Chicken FGF2 protein, His-tagged
Cat.No. : | FGF2-5632C |
Product Overview : | Recombinant Chicken FGF2 protein(P48800)(13-158aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | Yeast |
Tag : | His |
Protein Length : | 13-158aa |
Tag : | N-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.3 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS |
◆ Recombinant Proteins | ||
FGF2-12B | Recombinant Bovine FGF2 Protein | +Inquiry |
FGF2-2785R | Recombinant Rabbit FGF2 protein, His-tagged | +Inquiry |
FGF2-19H | Active Recombinant Human FGF2 protein, ERHV-His-tagged | +Inquiry |
FGF2-1H | Active Recombinant Human FGF basic protein | +Inquiry |
FGF2-8856H | Active Recombinant Human Fibroblast Growth Factor 2 (basic) | +Inquiry |
◆ Native Proteins | ||
FGF2-065C | Recombinant Chicken FGF Basic Protein, Tag Free | +Inquiry |
FGF2-34B | Active Native Bovine bFGF | +Inquiry |
FGF2-26551TH | Native Human FGF2 | +Inquiry |
FGF2-066D | Recombinant Duck FGF Basic Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF2-638HCL | Recombinant Human FGF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF2 Products
Required fields are marked with *
My Review for All FGF2 Products
Required fields are marked with *