Recombinant Chicken IL2 Protein, Biotinylated Conjugated

Cat.No. : IL2-03C
Product Overview : The Chicken IL-2 recombinant protein without tag was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Chicken
Source : Yeast
Description : Interleukin-2 (IL-2) is a cytokine produced by T-helper cells in response to antigenic or mitogenic stimulation. It is required for T-cell proliferation and other activities crucial to the regulation of the immune response. IL-2 was discovered to be a member of a family of cytokines, which also includes IL-4, IL-7, IL-9, IL-15 and IL-21. IL-2 signals through a receptor complex consisting of IL-2 specific IL-2 receptor alpha (CD25), IL-2 receptor beta (CD122) and a common gamma chain (γc). All members of this family use the common gamma chain as part of their signaling complex.
Molecular Mass : 14.0 kDa
AA Sequence : ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK(121)
Applications : The Chicken IL-2 endotoxin-free recombinant protein can be used in cell culture.
Conjugation : Biotin
Gene Name IL2 interleukin 15 [ Gallus gallus (chicken) ]
Official Symbol IL2
Synonyms IL2; interleukin 2; IL-2; interleukin-2
Gene ID 373958
mRNA Refseq NM_204153
Protein Refseq NP_989484
UniProt ID O42288

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL2 Products

Required fields are marked with *

My Review for All IL2 Products

Required fields are marked with *

0
cart-icon