Recombinant Chicken IL2 Protein, Biotinylated Conjugated
| Cat.No. : | IL2-03C |
| Product Overview : | The Chicken IL-2 recombinant protein without tag was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Chicken |
| Source : | Yeast |
| Description : | Interleukin-2 (IL-2) is a cytokine produced by T-helper cells in response to antigenic or mitogenic stimulation. It is required for T-cell proliferation and other activities crucial to the regulation of the immune response. IL-2 was discovered to be a member of a family of cytokines, which also includes IL-4, IL-7, IL-9, IL-15 and IL-21. IL-2 signals through a receptor complex consisting of IL-2 specific IL-2 receptor alpha (CD25), IL-2 receptor beta (CD122) and a common gamma chain (γc). All members of this family use the common gamma chain as part of their signaling complex. |
| Molecular Mass : | 14.0 kDa |
| AA Sequence : | ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK(121) |
| Applications : | The Chicken IL-2 endotoxin-free recombinant protein can be used in cell culture. |
| Conjugation : | Biotin |
| Gene Name | IL2 interleukin 15 [ Gallus gallus (chicken) ] |
| Official Symbol | IL2 |
| Synonyms | IL2; interleukin 2; IL-2; interleukin-2 |
| Gene ID | 373958 |
| mRNA Refseq | NM_204153 |
| Protein Refseq | NP_989484 |
| UniProt ID | O42288 |
| ◆ Recombinant Proteins | ||
| IL2-432L | Recombinant Llama IL2 protein, His-tagged | +Inquiry |
| IL2-635C | Recombinant Cattle IL2 protein, His & T7-tagged | +Inquiry |
| IL2-3574D | Recombinant Dog IL2 protein, rFc-tagged | +Inquiry |
| IL2-028E | Active Recombinant Human IL2 (21-153aa), Met tagged | +Inquiry |
| IL2-3100R | Recombinant Rabbit IL2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL2-5234HCL | Recombinant Human IL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL2 Products
Required fields are marked with *
My Review for All IL2 Products
Required fields are marked with *
