Recombinant Chicken IL2 Protein, Biotinylated Conjugated
Cat.No. : | IL2-03C |
Product Overview : | The Chicken IL-2 recombinant protein without tag was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | Yeast |
Description : | Interleukin-2 (IL-2) is a cytokine produced by T-helper cells in response to antigenic or mitogenic stimulation. It is required for T-cell proliferation and other activities crucial to the regulation of the immune response. IL-2 was discovered to be a member of a family of cytokines, which also includes IL-4, IL-7, IL-9, IL-15 and IL-21. IL-2 signals through a receptor complex consisting of IL-2 specific IL-2 receptor alpha (CD25), IL-2 receptor beta (CD122) and a common gamma chain (γc). All members of this family use the common gamma chain as part of their signaling complex. |
Molecular Mass : | 14.0 kDa |
AA Sequence : | ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK(121) |
Applications : | The Chicken IL-2 endotoxin-free recombinant protein can be used in cell culture. |
Gene Name | IL2 interleukin 15 [ Gallus gallus (chicken) ] |
Official Symbol | IL2 |
Synonyms | IL2; interleukin 2; IL-2; interleukin-2 |
Gene ID | 373958 |
mRNA Refseq | NM_204153 |
Protein Refseq | NP_989484 |
UniProt ID | O42288 |
◆ Recombinant Proteins | ||
IL2-155H | Active Recombinant Human IL2 Protein | +Inquiry |
Il2-747R | Recombinant Rat Il2 protein(Ala21-Gln155) | +Inquiry |
IL2-02R | Recombinant Rabbit IL2 Protein | +Inquiry |
IL2-113E | Recombinant Horse IL2 protein | +Inquiry |
Il2-465M | Active Recombinant Mouse Interleukin 2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL2-5234HCL | Recombinant Human IL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL2 Products
Required fields are marked with *
My Review for All IL2 Products
Required fields are marked with *