Recombinant Chicken VEGFA protein
Cat.No. : | VEGFA-5328C |
Product Overview : | Recombinant Chicken VEGFA protein(P67964)(27-216 aa) was expressed in Baculovirus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | Baculovirus |
Tag : | Non |
Protein Length : | 27-216 aa |
Form : | Tris/PBS-based buffer, 6% Trehalose. |
AASequence : | APALGDGERKPNEVIKFLEVYERSFCRTIETLVDIFQEYPDEVEYIFRPSCVPLMRCAGC CGDEGLECVPVDVYNVTMEIARIKPHQSQHIAHMSFLQHSKCDCRPKKDVKNKQEKKSKR GKGKGQKRKRKKGRYKPPSFHCEPCSERRKHLFVQDPQTCKCSCKFTDSRCKSRQLELNE RTCRCEKPRR |
Purity : | >85% (SDS-PAGE) |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
VEGFA-5743H | Recombinant Human VEGFA protein, His-Avi-tagged, Biotinylated | +Inquiry |
VEGFA-0504H | Recombinant Human VEGFA Protein (V40-K134), His tagged | +Inquiry |
VEGFA-377M | Active Recombinant Mouse VEGF120 Protein, His & Avi-tagged, Biotinylated | +Inquiry |
VEGFA-206P | Recombinant Pig VEGFA Protein (Ala27-Arg190), C-His tagged, Animal-free, Carrier-free | +Inquiry |
VEGFA-6844H | Recombinant Horse VEGFA protein, His&Myc-tagged | +Inquiry |
◆ Native Proteins | ||
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
VEGFA-727HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-647MCL | Recombinant Mouse VEGFA cell lysate | +Inquiry |
VEGFA-522RCL | Recombinant Rat VEGFA cell lysate | +Inquiry |
VEGFA-969CCL | Recombinant Canine VEGFA cell lysate | +Inquiry |
VEGFA-1427HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VEGFA Products
Required fields are marked with *
My Review for All VEGFA Products
Required fields are marked with *