Recombinant Chicken VEGFA protein
| Cat.No. : | VEGFA-5328C |
| Product Overview : | Recombinant Chicken VEGFA protein(P67964)(27-216 aa) was expressed in Baculovirus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Chicken |
| Source : | Baculovirus |
| Tag : | Non |
| Protein Length : | 27-216 aa |
| Form : | Tris/PBS-based buffer, 6% Trehalose. |
| AASequence : | APALGDGERKPNEVIKFLEVYERSFCRTIETLVDIFQEYPDEVEYIFRPSCVPLMRCAGC CGDEGLECVPVDVYNVTMEIARIKPHQSQHIAHMSFLQHSKCDCRPKKDVKNKQEKKSKR GKGKGQKRKRKKGRYKPPSFHCEPCSERRKHLFVQDPQTCKCSCKFTDSRCKSRQLELNE RTCRCEKPRR |
| Purity : | >85% (SDS-PAGE) |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| ◆ Recombinant Proteins | ||
| Vegfa-475M | Active Recombinant Mouse Vegfa protein(Met1-Arg190) | +Inquiry |
| Vegfa-165R | Recombinant Rat Vegfa protein, His/S-tagged | +Inquiry |
| VEGFA-868H | Recombinant Human Vascular Endothelial Growth Factor A, His-tagged | +Inquiry |
| VEGFA-5326C | Recombinant Chicken VEGFA protein | +Inquiry |
| VEGFA-595R | Recombinant Rabbit VEGFA protein, His & T7-tagged | +Inquiry |
| ◆ Native Proteins | ||
| VEGFA-31701TH | Native Human VEGFA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VEGFA-1427HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-974HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-727HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-655HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-522RCL | Recombinant Rat VEGFA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VEGFA Products
Required fields are marked with *
My Review for All VEGFA Products
Required fields are marked with *
