Recombinant Chicken VEGFA protein, Avi-tagged, Biotinylated
| Cat.No. : | VEGFA-5327C |
| Product Overview : | Biotinylated Recombinant Chicken VEGFA protein(P67964)(27-216 aa), fused with Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Chicken |
| Source : | E.coli |
| Tag : | Avi |
| Protein Length : | 27-216 aa |
| Conjugation/Label : | Biotin |
| Form : | Tris/PBS-based buffer, 6% Trehalose. |
| AASequence : | APALGDGERKPNEVIKFLEVYERSFCRTIETLVDIFQEYPDEVEYIFRPSCVPLMRCAGC CGDEGLECVPVDVYNVTMEIARIKPHQSQHIAHMSFLQHSKCDCRPKKDVKNKQEKKSKR GKGKGQKRKRKKGRYKPPSFHCEPCSERRKHLFVQDPQTCKCSCKFTDSRCKSRQLELNE RTCRCEKPRR |
| Purity : | >85% (SDS-PAGE) |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Conjugation : | Biotin |
| ◆ Recombinant Proteins | ||
| VEGFA-048V | Active Recombinant Human VEGF165 Protein (165 aa) | +Inquiry |
| Vegfa-7368M | Active Recombinant Mouse Vegfa Protein | +Inquiry |
| VEGFA-25H | Active Recombinant Human VEGF 162 | +Inquiry |
| VEGFA-210H | Active Recombinant Human VEGFA | +Inquiry |
| Vegfa-357M | Recombinant Mouse Vascular Endothelial Growth Factor A | +Inquiry |
| ◆ Native Proteins | ||
| VEGFA-31701TH | Native Human VEGFA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VEGFA-974HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-647MCL | Recombinant Mouse VEGFA cell lysate | +Inquiry |
| VEGFA-1427HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-969CCL | Recombinant Canine VEGFA cell lysate | +Inquiry |
| VEGFA-727HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VEGFA Products
Required fields are marked with *
My Review for All VEGFA Products
Required fields are marked with *
