Recombinant Common timothy Phl p 5a protein, His-SUMO & Myc-tagged
| Cat.No. : | Phl p 5a-4477C | 
| Product Overview : | Recombinant Common timothy Phl p 5a protein(Q40962)(1-286aa), fused to N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in E. coli | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Timothy | 
| Source : | E.coli | 
| Tag : | His&Myc&SUMO | 
| Protein Length : | 1-286aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.  | 
                                
| Molecular Mass : | 48.5 kDa | 
| AA Sequence : | ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV | 
| Purity : | Greater than 85% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. | 
| ◆ Recombinant Proteins | ||
| Phl p 5a-045P | Recombinant Phleum pratense Phl p 5a Allergen, His tagged | +Inquiry | 
| Phl p 5a-4477C | Recombinant Common timothy Phl p 5a protein, His-SUMO & Myc-tagged | +Inquiry | 
| Phl p 5a-044P | Recombinant Phleum pratense Phl p 5a Allergen, His tagged, Biotinylated | +Inquiry | 
| Phl p 5a-4476C | Recombinant Common timothy Phl p 5a protein, His-SUMO-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All Phl p 5a Products
Required fields are marked with *
My Review for All Phl p 5a Products
Required fields are marked with *
  
        
    
      
            