Recombinant Cyan Fluorescent Protein, His-tagged
| Cat.No. : | CFP-187 |
| Product Overview : | The recombinant CFP (Cyan Fluorescent Protein) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal CFP fluorescence. Endotoxin has been removed, so the protein is suitable for in vivo injection or cell culture applications. The protein is a 31.3 kDa monomer with 284 amino acids and an N-terminal His-tag。 Ex./Em. = 458/480 nm Extinction coefficient: 26000M-1CM-1. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E.coli |
| Tag : | Non |
| Description : | Cyan Fluorescent Protein (CFP) is a versatile biological marker for monitoring physiological processes, visualizing protein localization, and detecting transgenic expression in vivo. |
| Form : | Lyophilized protein, Freeze Dried |
| Molecular Mass : | 31.3 kDa |
| AA Sequence : | MSGGEELFAGIVPVLIELDGDVHGHKFSVRGEGEGDADYGKLEIKFICTTGKLPVPWPTLVTTLAWGIQCFARYPEHMKMNDFFKSAMPEGYIQERTIHFQDDGKYKTRGEVKFEGDTLVNRVELKGEGFKEDGNILGHKLEYSAISDNVYIMPDKANNGLEANFKIRHNIEGGGVQLADHYQTNVPLGDGPVLIPINHYLSCQSAISKDRNEARDHMVLLESFSAYCHTHGMDELYRSGLRSRAQASNSAVDGTAGPGSTGSR |
| Endotoxin : | < 0.1 ng/μg |
| Purity : | ≥ 97% |
| Applications : | The protein is suitable as a control reagent for CFP expression studies or as a labeling reagent. Applications include: Use as standards for SDS-PAGE, Western blot analysis of CFP transfected cells, label other proteins, calibration of fluorometers and flow cytometers, fluorescence microscope, or microinjection of CFP into cells and tissues, etc. The recombinant CFP is ideal for fusion tag applications and is perfect for triple labeling with EGFP, RFP or YFP. |
| Usage : | For Research Use Only! Not For Use in Humans. |
| Storage : | Store at -20 centigrade; Store at-80 centigrade for long-term storage. |
| Reconstitution : | Reconstitute with dH2O to 1 mg/mL |
| Shipping : | Gel Pack |
| ◆ Recombinant Proteins | ||
| CFP-7679H | Recombinant Human CFP protein, His & T7-tagged | +Inquiry |
| CFP-252H | Recombinant Human CFP, His-tagged | +Inquiry |
| CFP-29037TH | Recombinant Human CFP | +Inquiry |
| CFP-210M | Recombinant Mouse CFP protein, His-tagged | +Inquiry |
| Cfp-2691M | Recombinant Mouse Cfp protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CFP-106H | Active Native Human Complement Factor P (Properdin) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CFP-7552HCL | Recombinant Human CFP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFP Products
Required fields are marked with *
My Review for All CFP Products
Required fields are marked with *



