Recombinant Cynomolgus ANGPTL4(Pro166-Ser406) Protein, N-10*His-tagged
| Cat.No. : | ANGPTL4-129C |
| Product Overview : | Recombinant Cynomolgus ANGPTL4(Pro166-Ser406) Protein, fused with His tag, was expressed in HEK293. |
| Availability | September 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cynomolgus |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | Pro166-Ser406 |
| Form : | Lyophilized from PBS, pH 7.4, 5% Trehalose, 5% Mannitol. |
| Molecular Mass : | The protein has a calculated MW of 27.9 kDa. |
| AA Sequence : | HHHHHHPEMAQPVDSAHNASRLHRLPRDCQELFEDGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPQGEFWLGLEKVHSITGDRNSRLAVQLQDWDGNAESLQFSVHLGGEDTAYSLQLTEPVASQLGATTVPPSSLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQELKKGIFWKTWRGRYYPLQATTMLIQPTAAEAAS |
| Endotoxin : | < 1EU/ug by LAL. |
| Purity : | > 90 % as determined by SDS-PAGE. |
| Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.5 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| ◆ Recombinant Proteins | ||
| ANGPTL4-496H | Recombinant Human ANGPTL4 Protein, DDK/His-tagged | +Inquiry |
| ANGPTL4-495H | Recombinant Human ANGPTL4 Protein, His/DDK-tagged | +Inquiry |
| ANGPTL4-5742H | Recombinant Human ANGPTL4 protein, His & GST-tagged | +Inquiry |
| ANGPTL4-2470H | Recombinant Human ANGPTL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ANGPTL4-4816H | Recombinant Human ANGPTL4 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANGPTL4-746MCL | Recombinant Mouse ANGPTL4 cell lysate | +Inquiry |
| ANGPTL4-1097HCL | Recombinant Human ANGPTL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (1)
- Q&As (0)
Customer Reviews
Write a reviewReviews
03/11/2026
I was hoping to get 2 quantity not 1 so if that could be adjusted I can send that to my purchasing contact, and the previous recombinant we ordered worked well.
Ask a Question for All ANGPTL4 Products
Required fields are marked with *
My Review for All ANGPTL4 Products
Required fields are marked with *
