Recombinant Cynomolgus ANGPTL4(Pro166-Ser406) Protein, N-10*His-tagged
Cat.No. : | ANGPTL4-129C |
Product Overview : | Recombinant Cynomolgus ANGPTL4(Pro166-Ser406) Protein, fused with His tag, was expressed in HEK293. |
Availability | August 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | HEK293 |
Tag : | His |
Protein Length : | Pro166-Ser406 |
Form : | Lyophilized from PBS, pH 7.4, 5% Trehalose, 5% Mannitol. |
Molecular Mass : | The protein has a calculated MW of 27.9 kDa. |
AA Sequence : | HHHHHHPEMAQPVDSAHNASRLHRLPRDCQELFEDGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPQGEFWLGLEKVHSITGDRNSRLAVQLQDWDGNAESLQFSVHLGGEDTAYSLQLTEPVASQLGATTVPPSSLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQELKKGIFWKTWRGRYYPLQATTMLIQPTAAEAAS |
Endotoxin : | < 1EU/ug by LAL. |
Purity : | > 90 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.5 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
◆ Recombinant Proteins | ||
ANGPTL4-268H | Active Recombinant Human ANGPTL4 protein, His-tagged | +Inquiry |
Angptl4-5745R | Recombinant Rat Angptl4 protein, His & T7-tagged | +Inquiry |
Angptl4-102R | Recombinant Rat Angptl4, FLAG-tagged | +Inquiry |
ANGPTL4-496H | Recombinant Human ANGPTL4 Protein, DDK/His-tagged | +Inquiry |
ANGPTL4-1468C | Recombinant Cynomolgus ANGPTL4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANGPTL4-1097HCL | Recombinant Human ANGPTL4 cell lysate | +Inquiry |
ANGPTL4-746MCL | Recombinant Mouse ANGPTL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANGPTL4 Products
Required fields are marked with *
My Review for All ANGPTL4 Products
Required fields are marked with *