Recombinant Cynomolgus CTSD Protein, His-tagged
Cat.No. : | CTSD-429C |
Product Overview : | Recombinant Cynomolgus CTSD Protein(NP_001270485.1), fused to His-tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | HEK293 |
Tag : | His |
Form : | 0.2 μm sterile filtered PBS buffer. |
Molecular Mass : | The predicted molecular mass is 43 kDa, and the actual MW is about 40-50 kDa in SDS-PAGE under reducing conditions. |
AA Sequence : | LVRIPLHKFTSIRRTMSEIGGPVEDLIAKGPISKYSQAMPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWLHHKYNSDKSSTYVKNGTSFAIHYGSGSLSGYLSQDTVSVPCKSAPSTAALGGVKVERQVFGEAIKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLNRDPTAQPGGELMLGGTDSKYYRGSLSYLNVTRKAYWQVRLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPTITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARLHHHHHH |
Endotoxin : | <1.0 EU per mg of the protein by the LAL method |
Purity : | ≥ 95%, by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.83 mg/ml |
Gene Name | CTSD cathepsin D [ Macaca fascicularis (crab-eating macaque) ] |
Official Symbol | CTSD |
Synonyms | CTSD |
Gene ID | 102125635 |
mRNA Refseq | NM_001283556.1 |
Protein Refseq | NP_001270485.1 |
◆ Recombinant Proteins | ||
CTSD-218H | Recombinant Human CTSD, His-tagged | +Inquiry |
CTSD-2757H | Recombinant Human CTSD protein, His-tagged | +Inquiry |
Ctsd-6760M | Recombinant Mouse Ctsd protein, His-tagged | +Inquiry |
CTSD-11684H | Recombinant Human CTSD, GST-tagged | +Inquiry |
CTSD-435C | Recombinant Cricetulus Griseus CTSD Protein (65-408 aa), His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
CTSD-26411TH | Active Native Human Cathepsin D protein | +Inquiry |
CTSD-5325D | Active Native Human CTSD protein | +Inquiry |
CTSD-1648H | Active Native Human Cathepsin D | +Inquiry |
CTSD-27858TH | Native Human CTSD | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSD-1735HCL | Recombinant Human CTSD cell lysate | +Inquiry |
CTSD-3023MCL | Recombinant Mouse CTSD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSD Products
Required fields are marked with *
My Review for All CTSD Products
Required fields are marked with *