Recombinant Cynomolgus CTSD Protein, His-tagged

Cat.No. : CTSD-429C
Product Overview : Recombinant Cynomolgus CTSD Protein(NP_001270485.1), fused to His-tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cynomolgus
Source : HEK293
Tag : His
Form : 0.2 μm sterile filtered PBS buffer.
Molecular Mass : The predicted molecular mass is 43 kDa, and the actual MW is about 40-50 kDa in SDS-PAGE under reducing conditions.
AA Sequence : LVRIPLHKFTSIRRTMSEIGGPVEDLIAKGPISKYSQAMPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWLHHKYNSDKSSTYVKNGTSFAIHYGSGSLSGYLSQDTVSVPCKSAPSTAALGGVKVERQVFGEAIKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLNRDPTAQPGGELMLGGTDSKYYRGSLSYLNVTRKAYWQVRLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPTITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARLHHHHHH
Endotoxin : <1.0 EU per mg of the protein by the LAL method
Purity : ≥ 95%, by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.83 mg/ml
Gene Name CTSD cathepsin D [ Macaca fascicularis (crab-eating macaque) ]
Official Symbol CTSD
Synonyms CTSD
Gene ID 102125635
mRNA Refseq NM_001283556.1
Protein Refseq NP_001270485.1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTSD Products

Required fields are marked with *

My Review for All CTSD Products

Required fields are marked with *

0
cart-icon