Recombinant Cynomolgus CTSD Protein, His-tagged

• Cat.No.: CTSD-429C
• Product Overview: Recombinant Cynomolgus CTSD Protein(NP_001270485.1), fused to His-tag, was expressed in HEK293.

Specification

• Species: Cynomolgus
• Source: HEK293
• Tag: His
• Form: 0.2 μm sterile filtered PBS buffer.
• Molecular Mass: The predicted molecular mass is 43 kDa, and the actual MW is about 40-50 kDa in SDS-PAGE under reducing conditions.
• AA Sequence: LVRIPLHKFTSIRRTMSEIGGPVEDLIAKGPISKYSQAMPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWLHHKYNSDKSSTYVKNGTSFAIHYGSGSLSGYLSQDTVSVPCKSAPSTAALGGVKVERQVFGEAIKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLNRDPTAQPGGELMLGGTDSKYYRGSLSYLNVTRKAYWQVRLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPTITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARLHHHHHH
• Endotoxin: <1.0 EU per mg of the protein by the LAL method
• Purity: ≥ 95%, by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.83 mg/ml

Gene Information

• Gene Name: CTSD cathepsin D [ Macaca fascicularis (crab-eating macaque) ]
• Official Symbol: CTSD
• Synonyms: CTSD
• Gene ID: 102125635
• mRNA Refseq: NM_001283556.1
• Protein Refseq: NP_001270485.1