Recombinant Cynomolgus CTSD Protein, His-tagged
| Cat.No. : | CTSD-429C |
| Product Overview : | Recombinant Cynomolgus CTSD Protein(NP_001270485.1), fused to His-tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cynomolgus |
| Source : | HEK293 |
| Tag : | His |
| Form : | 0.2 μm sterile filtered PBS buffer. |
| Molecular Mass : | The predicted molecular mass is 43 kDa, and the actual MW is about 40-50 kDa in SDS-PAGE under reducing conditions. |
| AA Sequence : | LVRIPLHKFTSIRRTMSEIGGPVEDLIAKGPISKYSQAMPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWLHHKYNSDKSSTYVKNGTSFAIHYGSGSLSGYLSQDTVSVPCKSAPSTAALGGVKVERQVFGEAIKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLNRDPTAQPGGELMLGGTDSKYYRGSLSYLNVTRKAYWQVRLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPTITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARLHHHHHH |
| Endotoxin : | <1.0 EU per mg of the protein by the LAL method |
| Purity : | ≥ 95%, by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.83 mg/ml |
| Gene Name | CTSD cathepsin D [ Macaca fascicularis (crab-eating macaque) ] |
| Official Symbol | CTSD |
| Synonyms | CTSD |
| Gene ID | 102125635 |
| mRNA Refseq | NM_001283556.1 |
| Protein Refseq | NP_001270485.1 |
| ◆ Recombinant Proteins | ||
| CTSD-913R | Recombinant Rhesus Macaque CTSD Protein, His (Fc)-Avi-tagged | +Inquiry |
| CTSD-854H | Recombinant Human CTSD Protein, GST-His-tagged | +Inquiry |
| CTSD-435C | Recombinant Cricetulus Griseus CTSD Protein (65-408 aa), His-SUMO-tagged | +Inquiry |
| CTSD-1884H | Recombinant Human CTSD Protein (Arg23-Gln161), N-His tagged | +Inquiry |
| CTSD-218H | Recombinant Human CTSD, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CTSD-27858TH | Native Human CTSD | +Inquiry |
| CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
| CTSD-5325D | Active Native Human CTSD protein | +Inquiry |
| CTSD-1648H | Active Native Human Cathepsin D | +Inquiry |
| CTSD-26411TH | Active Native Human Cathepsin D protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTSD-1735HCL | Recombinant Human CTSD cell lysate | +Inquiry |
| CTSD-3023MCL | Recombinant Mouse CTSD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSD Products
Required fields are marked with *
My Review for All CTSD Products
Required fields are marked with *
