Recombinant Human CTSD protein, His-tagged
Cat.No. : | CTSD-2757H |
Product Overview : | Recombinant Human CTSD protein(P07339)(67-403aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 67-403aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.8 kDa |
AA Sequence : | IPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CTSD cathepsin D [ Homo sapiens ] |
Official Symbol | CTSD |
Synonyms | CTSD; cathepsin D; cathepsin D (lysosomal aspartyl protease) , CPSD; ceroid lipofuscinosis; neuronal 10; CLN10; lysosomal aspartyl protease; lysosomal aspartyl peptidase; ceroid-lipofuscinosis, neuronal 10; CPSD; MGC2311; |
Gene ID | 1509 |
mRNA Refseq | NM_001909 |
Protein Refseq | NP_001900 |
MIM | 116840 |
UniProt ID | P07339 |
◆ Recombinant Proteins | ||
CTSD-6918H | Recombinant Full Length Human CTSD, His tagged | +Inquiry |
Ctsd-6762R | Recombinant Rat Ctsd protein, His & GST-tagged | +Inquiry |
CTSD-2752H | Recombinant Human CTSD Protein, His (Fc)-Avi-tagged | +Inquiry |
Ctsd-4222R | Recombinant Rat Ctsd protein, His&Myc-tagged | +Inquiry |
CTSD-1058H | Recombinant Human CTSD Protein (Leu21-Leu412), C-His tagged | +Inquiry |
◆ Native Proteins | ||
CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
CTSD-26411TH | Active Native Human Cathepsin D protein | +Inquiry |
CTSD-5325D | Active Native Human CTSD protein | +Inquiry |
CTSD-27858TH | Native Human CTSD | +Inquiry |
CTSD-1648H | Active Native Human Cathepsin D | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSD-3023MCL | Recombinant Mouse CTSD cell lysate | +Inquiry |
CTSD-1735HCL | Recombinant Human CTSD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSD Products
Required fields are marked with *
My Review for All CTSD Products
Required fields are marked with *