Recombinant Human CTSD protein, GST-tagged
| Cat.No. : | CTSD-2758H |
| Product Overview : | Recombinant Human CTSD protein(P07339)(67-403aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 67-403aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 63.8 kDa |
| AA Sequence : | IPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CTSD cathepsin D [ Homo sapiens ] |
| Official Symbol | CTSD |
| Synonyms | CTSD; cathepsin D; cathepsin D (lysosomal aspartyl protease) , CPSD; ceroid lipofuscinosis; neuronal 10; CLN10; lysosomal aspartyl protease; lysosomal aspartyl peptidase; ceroid-lipofuscinosis, neuronal 10; CPSD; MGC2311; |
| Gene ID | 1509 |
| mRNA Refseq | NM_001909 |
| Protein Refseq | NP_001900 |
| MIM | 116840 |
| UniProt ID | P07339 |
| ◆ Recombinant Proteins | ||
| CTSD-429C | Recombinant Cynomolgus CTSD Protein, His-tagged | +Inquiry |
| CTSD-2341HF | Recombinant Full Length Human CTSD Protein, GST-tagged | +Inquiry |
| CTSD-435C | Recombinant Cricetulus Griseus CTSD Protein (65-408 aa), His-SUMO-tagged | +Inquiry |
| CTSD-90H | Recombinant Human Cathepsin D | +Inquiry |
| CTSD-9232Z | Recombinant Zebrafish CTSD | +Inquiry |
| ◆ Native Proteins | ||
| CTSD-26411TH | Active Native Human Cathepsin D protein | +Inquiry |
| CTSD-27858TH | Native Human CTSD | +Inquiry |
| CTSD-5325D | Active Native Human CTSD protein | +Inquiry |
| CTSD-1648H | Active Native Human Cathepsin D | +Inquiry |
| CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTSD-1735HCL | Recombinant Human CTSD cell lysate | +Inquiry |
| CTSD-130HKCL | Human CTSD Knockdown Cell Lysate | +Inquiry |
| CTSD-3023MCL | Recombinant Mouse CTSD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSD Products
Required fields are marked with *
My Review for All CTSD Products
Required fields are marked with *
