"Apoe" Related Products

Expand
Expand
Expand

Recombinant Mouse Apoe protein, His-tagged

Cat.No.: Apoe-25M
Product Overview: Recombinant Mouse Apoe(Glu19-Gln311) fused with His tag at C-terminal was expressed in HEK293.
Description: Apolipoprotein E (Apo-E), is a member of the apolipoprotein A1/A4/E family. APOE may function in mediating the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues. APOE is usually secreted in plasma. Phosphorylation sites are present in the extracellular medium.
Source: HEK293
Species: Mouse
Tag: His
Form: Supplied as a 0.2 μm filtered solution of MOPS, NaCl, CHAPS and TCEP
AA Sequence: EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKA YKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLS THLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPL RDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPI VEDMHRQWANLMEKIQASVATNPIITPVAQENQVDHHHHHH*
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
Gene Name: Apoe apolipoprotein E [ Mus musculus ]
Official Symbol: Apoe
Synonyms: APOE; apolipoprotein E; apo-E; AI255918;
Gene ID: 11816
mRNA Refseq: NM_009696
Protein Refseq: NP_033826
MIM:
UniProt ID: P08226
Chromosome Location: 7 A3; 7 9.94 cM
Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Chylomicron-mediated lipid transport, organism-specific biosystem; HDL-mediated lipid transport, organism-specific biosystem; Lipid digestion, mobilization, and transport, organism-specific biosystem; Lipoprotein metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem;
Function: antioxidant activity; beta-amyloid binding; cholesterol transporter activity; heparin binding; identical protein binding; lipid binding; lipid transporter activity; lipoprotein particle binding; low-density lipoprotein particle receptor binding; metal chelating activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.