Recombinant Mouse Apoe protein, His-tagged
| Cat.No. : | Apoe-25M |
| Product Overview : | Recombinant Mouse Apoe(Glu19-Gln311) fused with His tag at C-terminal was expressed in HEK293. |
| Availability | January 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 19-311 a.a. |
| Description : | Apolipoprotein E (Apo-E), is a member of the apolipoprotein A1/A4/E family. APOE may function in mediating the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues. APOE is usually secreted in plasma. Phosphorylation sites are present in the extracellular medium. |
| Form : | Supplied as a 0.2 μm filtered solution of MOPS, NaCl, CHAPS and TCEP |
| AA Sequence : | EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKA YKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLS THLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPL RDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPI VEDMHRQWANLMEKIQASVATNPIITPVAQENQVDHHHHHH* |
| Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Storage : | Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles. |
| Publications : |
| Gene Name | Apoe apolipoprotein E [ Mus musculus ] |
| Official Symbol | Apoe |
| Synonyms | APOE; apolipoprotein E; apo-E; AI255918; |
| Gene ID | 11816 |
| mRNA Refseq | NM_009696 |
| Protein Refseq | NP_033826 |
| MIM | |
| UniProt ID | P08226 |
| Chromosome Location | 7 A3; 7 9.94 cM |
| Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Chylomicron-mediated lipid transport, organism-specific biosystem; HDL-mediated lipid transport, organism-specific biosystem; Lipid digestion, mobilization, and transport, organism-specific biosystem; Lipoprotein metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; |
| Function | antioxidant activity; beta-amyloid binding; cholesterol transporter activity; heparin binding; identical protein binding; lipid binding; lipid transporter activity; lipoprotein particle binding; low-density lipoprotein particle receptor binding; metal chelating activity; |
| ◆ Recombinant Proteins | ||
| APOE-0240H | Recombinant Human APOE protein, Trx-tagged, Biotinylated | +Inquiry |
| Apoe-687M | Recombinant Mouse Apoe protein, His & GST-tagged | +Inquiry |
| APOE4-2869H | Recombinant Human APOE4 protein, His&Trx-tagged | +Inquiry |
| Apoe-25M | Recombinant Mouse Apoe protein, His-tagged | +Inquiry |
| APOE-4562R | Recombinant Rhesus macaque APOE protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ApoE-3560H | Native Human ApoE | +Inquiry |
| APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
| APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APOE-8780HCL | Recombinant Human APOE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Apoe Products
Required fields are marked with *
My Review for All Apoe Products
Required fields are marked with *
