Recombinant Mouse Apoe protein, His-tagged

• Cat.No.: Apoe-25M
• Product Overview: Recombinant Mouse Apoe(Glu19-Gln311) fused with His tag at C-terminal was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Protein Length: 19-311 a.a.
• Description: Apolipoprotein E (Apo-E), is a member of the apolipoprotein A1/A4/E family. APOE may function in mediating the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues. APOE is usually secreted in plasma. Phosphorylation sites are present in the extracellular medium.
• Form: Supplied as a 0.2 μm filtered solution of MOPS, NaCl, CHAPS and TCEP
• AA Sequence: EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKA YKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLS THLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPL RDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPI VEDMHRQWANLMEKIQASVATNPIITPVAQENQVDHHHHHH*
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
• Publications:
  Multifunctional Bioreactive-Nanoconstructs for Sensitive and Accurate MRI of Cerebrospinal Fluid Pathology and Intervention of Alzheimer’s Disease (2020)

Gene Information

• Gene Name: Apoe apolipoprotein E [ Mus musculus ]
• Official Symbol: Apoe
• Synonyms: APOE; apolipoprotein E; apo-E; AI255918
• Gene ID: 11816
• mRNA Refseq: NM_009696
• Protein Refseq: NP_033826
• UniProt ID: P08226
• Chromosome Location: 7 A3; 7 9.94 cM
• Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Chylomicron-mediated lipid transport, organism-specific biosystem; HDL-mediated lipid transport, organism-specific biosystem; Lipid digestion, mobilization, and transport, organism-specific biosystem; Lipoprotein metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem
• Function: antioxidant activity; beta-amyloid binding; cholesterol transporter activity; heparin binding; identical protein binding; lipid binding; lipid transporter activity; lipoprotein particle binding; low-density lipoprotein particle receptor binding; metal chelating activity