Recombinant Mouse Apoe protein, His-tagged
Cat.No. : | Apoe-25M |
Product Overview : | Recombinant Mouse Apoe(Glu19-Gln311) fused with His tag at C-terminal was expressed in HEK293. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Protein Length : | 19-311 a.a. |
Description : | Apolipoprotein E (Apo-E), is a member of the apolipoprotein A1/A4/E family. APOE may function in mediating the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues. APOE is usually secreted in plasma. Phosphorylation sites are present in the extracellular medium. |
Form : | Supplied as a 0.2 μm filtered solution of MOPS, NaCl, CHAPS and TCEP |
AA Sequence : | EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKA YKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLS THLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPL RDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPI VEDMHRQWANLMEKIQASVATNPIITPVAQENQVDHHHHHH* |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles. |
Publications : |
Multifunctional Bioreactive-Nanoconstructs for Sensitive and Accurate MRI of Cerebrospinal Fluid Pathology and Intervention of Alzheimer’s Disease (2020)
|
Gene Name | Apoe apolipoprotein E [ Mus musculus ] |
Official Symbol | Apoe |
Synonyms | APOE; apolipoprotein E; apo-E; AI255918; |
Gene ID | 11816 |
mRNA Refseq | NM_009696 |
Protein Refseq | NP_033826 |
MIM | |
UniProt ID | P08226 |
Chromosome Location | 7 A3; 7 9.94 cM |
Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Chylomicron-mediated lipid transport, organism-specific biosystem; HDL-mediated lipid transport, organism-specific biosystem; Lipid digestion, mobilization, and transport, organism-specific biosystem; Lipoprotein metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; |
Function | antioxidant activity; beta-amyloid binding; cholesterol transporter activity; heparin binding; identical protein binding; lipid binding; lipid transporter activity; lipoprotein particle binding; low-density lipoprotein particle receptor binding; metal chelating activity; |
◆ Recombinant Proteins | ||
APOE-238HFL | Active Recombinant Full Length Human APOE Protein, C-Flag-tagged | +Inquiry |
APOE-695H | Recombinant Human Apolipoprotein E, E2 Isoform | +Inquiry |
Apoe-5608M | Recombinant Mouse Apoe protein, His-tagged | +Inquiry |
Apoe-543R | Recombinant Rat Apoe protein, His-tagged | +Inquiry |
APOE-1405H | Recombinant Human APOE protein, hFc-tagged | +Inquiry |
◆ Native Proteins | ||
APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
ApoE-3560H | Native Human ApoE | +Inquiry |
APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOE-8780HCL | Recombinant Human APOE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Apoe Products
Required fields are marked with *
My Review for All Apoe Products
Required fields are marked with *
0
Inquiry Basket