Recombinant Cynomolgus monkey FASLG protein, His-tagged
Cat.No. : | FASLG-2375C |
Product Overview : | Recombinant Cynomolgus monkey FASLG protein(P63308)(102-211aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | E.coli |
Tag : | His |
Protein Length : | 102-211aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.5 kDa |
AA Sequence : | QLFHLQKELAELRESTSQKHTASSLEKQIGHPSPPPEKKEQRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCTNLPLSHKVY |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
◆ Recombinant Proteins | ||
FASLG-1394H | Recombinant Human FASLG Protein (103-281 aa), His-tagged | +Inquiry |
FASLG-4272H | Recombinant Human FASLG Protein (Pro134-Leu281), C-His tagged | +Inquiry |
Faslg-372M | Recombinant Mouse Faslg protein(Pro132-Leu279), His-tagged | +Inquiry |
Fasl-01M | Active Recombinant Mouse Fasl Protein, His-Tagged | +Inquiry |
FASLG-2768H | Recombinant Human FASLG protein(141-280 aa), N-SUMO & N-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FASLG-6324HCL | Recombinant Human FASLG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FASLG Products
Required fields are marked with *
My Review for All FASLG Products
Required fields are marked with *