Recombinant Full Length Macaca Fascicularis Tumor Necrosis Factor Ligand Superfamily Member 6(Faslg) Protein, His-Tagged
| Cat.No. : | RFL23962MF |
| Product Overview : | Recombinant Full Length Macaca fascicularis Tumor necrosis factor ligand superfamily member 6(FASLG) Protein (P63308) (1-280aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Macaca fascicularis |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-280) |
| Form : | Lyophilized powder |
| AA Sequence : | MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPSPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQKHTASSLEKQIGHPSPPPEKKEQRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCTNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWAHSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | FASLG |
| Synonyms | FASLG; CD95L; FASL; TNFSF6; Tumor necrosis factor ligand superfamily member 6; CD95 ligand; CD95-L; Fas antigen ligand; Fas ligand; FasL; CD antigen CD178 |
| UniProt ID | P63308 |
| ◆ Recombinant Proteins | ||
| Faslg-373R | Recombinant Rat Faslg protein(Leu104-Leu278), His-tagged | +Inquiry |
| FASLG-1931R | Recombinant Rat FASLG Protein, His (Fc)-Avi-tagged | +Inquiry |
| FASLG-2703H | Recombinant Human FASLG, His-tagged | +Inquiry |
| FASLG-3857H | Recombinant Human FASLG Protein, GST-tagged | +Inquiry |
| FASLG-2180P | Recombinant Pig FASLG Protein, His&SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FASLG-6324HCL | Recombinant Human FASLG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FASLG Products
Required fields are marked with *
My Review for All FASLG Products
Required fields are marked with *



