Recombinant Cynomolgus monkey IL1A protein(113-271aa), His-Myc-tagged
Cat.No. : | IL1A-3982C |
Product Overview : | Recombinant Cynomolgus monkey IL1A protein(P79340)(113-271aa), fused with C-terminal His-Myc tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | Yeast |
Tag : | His&Myc |
Protein Length : | 113-271aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.9 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQYLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEIPKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA |
◆ Recombinant Proteins | ||
IL1A-149M | Active Recombinant Mouse IL1A Protein | +Inquiry |
Il1a-03M | Recombinant Mouse Interleukin-1 Alpha | +Inquiry |
IL1A-05H | Recombinant Human IL1A(Ser113-Ala271) Protein, C-Avi-tagged, Biotinylated | +Inquiry |
Il1a-097M | Active Recombinant Mouse Il1a Protein | +Inquiry |
IL1A-011D | Active Recombinant Dog IL1A Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IL1A-049H | Active Recombinant Human IL1A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1A-2911HCL | Recombinant Human IL1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1A Products
Required fields are marked with *
My Review for All IL1A Products
Required fields are marked with *