Recombinant Cynomolgus monkey SNCA protein, His-SUMO-tagged
| Cat.No. : | SNCA-3389M |
| Product Overview : | Recombinant Cynomolgus monkey SNCA protein(XP_005555479.1)(1-140aa), fused to His-SUMO-tag at N-terminus, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cynomolgus |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-140aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 30.5 kDa |
| AA Sequence : | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | SNCA synuclein alpha [ Macaca fascicularis (crab-eating macaque) ] |
| Official Symbol | SNCA |
| Synonyms | SNCA; Alpha-synuclein |
| Gene ID | 102119369 |
| mRNA Refseq | XM_005555422.2 |
| Protein Refseq | XP_005555479.1 |
| UniProt ID | P61142 |
| ◆ Recombinant Proteins | ||
| SNCA-295H | Recombinant Human Synuclein, Alpha (Non A4 Component of Amyloid Precursor), 1-95 | +Inquiry |
| SNCA-6456H | Recombinant Human SNCA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Snca-386M | Recombinant Mouse Snca Protein | +Inquiry |
| SNCA-75H | Recombinant Human SNCA, 112aa | +Inquiry |
| SNCA-3395S | Recombinant Saguinus labiatus (Red-chested mustached tamarin) SNCA, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| SNCA-27345TH | Native Human SNCA | +Inquiry |
| SNCA-27339TH | Native Human SNCA | +Inquiry |
| SNCA-27341TH | Native Human SNCA | +Inquiry |
| SNCA-27342TH | Native Human SNCA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNCA-1634HCL | Recombinant Human SNCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNCA Products
Required fields are marked with *
My Review for All SNCA Products
Required fields are marked with *



