Recombinant Cynomolgus monkey ZG16B protein, His-tagged
Cat.No. : | ZG16B-5642C |
Product Overview : | Recombinant Cynomolgus monkey ZG16B protein(G7Q0A1)(23-169aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | HEK293 |
Tag : | His |
Protein Length : | 23-169aa |
Tag : | C-His |
Form : | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis ZG16B at 2 μg/mL can bind Anti-ZG16B recombinant antibody, the EC50 is 20.15-28.98 ng/mL. |
Molecular Mass : | 17.6 kDa |
Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GKMYGPGGGKYFTTTEDYDHEITGLRVSVGLLLVKSVQVKLGDTWDVKQGASGGNTQEVTLQPGEYITKVFVAFQTFLRGMVLYTSKDRTFYFGKLDGQIFSVYPSQEGQVLVGIYGQYGLLGIKSIGFEWNYPLEEPTTEPPVTVT |
◆ Recombinant Proteins | ||
ZG16B-1024H | Recombinant Human ZG16B protein(53-208aa), His-tagged | +Inquiry |
ZG16B-1054H | Recombinant Human ZG16B Protein, His-tagged | +Inquiry |
ZG16B-1598H | Recombinant Human ZG16B protein, His-tagged | +Inquiry |
ZG16B-5618H | Recombinant Human ZG16B Protein (Gly53-Arg208), His tagged | +Inquiry |
ZG16B-5642C | Recombinant Cynomolgus monkey ZG16B protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZG16B-170HCL | Recombinant Human ZG16B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZG16B Products
Required fields are marked with *
My Review for All ZG16B Products
Required fields are marked with *
0
Inquiry Basket