Recombinant Human ZG16B protein(53-208aa), His-tagged

Cat.No. : ZG16B-1024H
Product Overview : Recombinant Human ZG16B protein(Q96DA0)(53-208aa), fused with C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 53-208aa
Form : Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Bio-activity : Measured by its binding ability in a functional ELISA. Immobilized Human ZG16B at 2 μg/mL can bind Anti-ZG16B recombinant antibody (CSB-RA836195MA1HU), the EC50 is 24.13-46.04 ng/mL.
Molecular Mass : 20.0 kDa
Endotoxin : Less than 1.0 EU/ug as determined by LAL method.
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Gene Name ZG16B zymogen granule protein 16 homolog B (rat) [ Homo sapiens ]
Official Symbol ZG16B
Synonyms ZG16B; zymogen granule protein 16 homolog B (rat); zymogen granule protein 16 homolog B; HRPE773; jacalin like lectin domain containing 2; JCLN2; PRO1567; endocrine and exocrine protein; jacalin-like lectin domain containing 2; pancreatic adenocarcinoma upregulated factor; EECP; PAUF;
Gene ID 124220
mRNA Refseq NM_145252
Protein Refseq NP_660295
UniProt ID Q96DA0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZG16B Products

Required fields are marked with *

My Review for All ZG16B Products

Required fields are marked with *

0
cart-icon
0
compare icon