Recombinant Human ZG16B protein(53-208aa), His-tagged

• Cat.No.: ZG16B-1024H
• Product Overview: Recombinant Human ZG16B protein(Q96DA0)(53-208aa), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 53-208aa
• Form: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Bio-activity: Measured by its binding ability in a functional ELISA. Immobilized Human ZG16B at 2 μg/mL can bind Anti-ZG16B recombinant antibody (CSB-RA836195MA1HU), the EC50 is 24.13-46.04 ng/mL.
• Molecular Mass: 20.0 kDa
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR

Gene Information

• Gene Name: ZG16B zymogen granule protein 16 homolog B (rat) [ Homo sapiens ]
• Official Symbol: ZG16B
• Synonyms: ZG16B; zymogen granule protein 16 homolog B (rat); zymogen granule protein 16 homolog B; HRPE773; jacalin like lectin domain containing 2; JCLN2; PRO1567; endocrine and exocrine protein; jacalin-like lectin domain containing 2; pancreatic adenocarcinoma upregulated factor; EECP; PAUF
• Gene ID: 124220
• mRNA Refseq: NM_145252
• Protein Refseq: NP_660295
• UniProt ID: Q96DA0