Recombinant Human ZG16B protein(53-208aa), His-tagged
| Cat.No. : | ZG16B-1024H |
| Product Overview : | Recombinant Human ZG16B protein(Q96DA0)(53-208aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 53-208aa |
| Form : | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Human ZG16B at 2 μg/mL can bind Anti-ZG16B recombinant antibody (CSB-RA836195MA1HU), the EC50 is 24.13-46.04 ng/mL. |
| Molecular Mass : | 20.0 kDa |
| Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR |
| Gene Name | ZG16B zymogen granule protein 16 homolog B (rat) [ Homo sapiens ] |
| Official Symbol | ZG16B |
| Synonyms | ZG16B; zymogen granule protein 16 homolog B (rat); zymogen granule protein 16 homolog B; HRPE773; jacalin like lectin domain containing 2; JCLN2; PRO1567; endocrine and exocrine protein; jacalin-like lectin domain containing 2; pancreatic adenocarcinoma upregulated factor; EECP; PAUF; |
| Gene ID | 124220 |
| mRNA Refseq | NM_145252 |
| Protein Refseq | NP_660295 |
| UniProt ID | Q96DA0 |
| ◆ Recombinant Proteins | ||
| ZG16B-5618H | Recombinant Human ZG16B Protein (Gly53-Arg208), His tagged | +Inquiry |
| ZG16B-1024H | Recombinant Human ZG16B protein(53-208aa), His-tagged | +Inquiry |
| ZG16B-1396HFL | Recombinant Full Length Human ZG16B Protein, C-Flag-tagged | +Inquiry |
| ZG16B-5642C | Recombinant Cynomolgus monkey ZG16B protein, His-tagged | +Inquiry |
| ZG16B-1598H | Recombinant Human ZG16B protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZG16B-170HCL | Recombinant Human ZG16B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZG16B Products
Required fields are marked with *
My Review for All ZG16B Products
Required fields are marked with *
